KEGG   Bordetella bronchiseptica S798: BBS798_2775Help
Entry
BBS798_2775       CDS       T03637                                 

Definition
(GenBank) iron binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
bbx  Bordetella bronchiseptica S798
Pathway
bbx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bbx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BBS798_2775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbx02000]
    BBS798_2775
Transporters [BR:bbx02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    BBS798_2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_1 SBP_bac_11 SBP_bac_8
Motif
Other DBs
NCBI-ProteinID: BAO69500
UniProt: A0A3T0NZ31
LinkDB All DBs
Position
3020631..3021680
Genome map
AA seq 349 aa AA seqDB search
MPSTKRSSLIPLLRALALAGVATFSAQALAADEVSLYTTREPKLIQPLLDAFAKDSGIKV
NTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRG
AEGSWYALSLRDRVLYVEKDLKLDSFRYEDLADPKWKGKVCIRSGQHPYNTALVAAMIAH
DGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDAR
KWGDAIKVVRPTFATAKDGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQAN
YEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaccaagcgttcctccctgatcccgctgctgcgcgccctggcgctcgcgggc
gttgccacgttctccgcccaggcgctggccgccgatgaggtcagcctctacaccacgcgc
gaacccaagctgatccagcctctgctcgacgccttcgccaaggacagcggcatcaaggtc
aacaccgtcttcgtcaaggacggcctgctcgaacgcgtcagggccgagggcgacaagtcg
ccggccgacgtgctgatgacggtcgacatcggcaacctgatcgacctggtcaatggcggc
gtcacccagaaaatccagtcgcagacgctcgacagcgtggtgcccgccaacctgcgcggc
gccgaaggcagctggtacgccctgtcgctgcgcgaccgggtgctctacgtcgagaaagac
ctcaagctggacagcttccgctacgaagacctggccgaccccaaatggaagggcaaggtg
tgcatccgctcgggccagcacccctacaacaccgcgctggtggcggccatgatcgcccat
gacggcgccgaggccaccgagaaatggctgcgcggcgtgaaggccaacctggcccgcaag
gcggccggcggcgaccgcgacgtggcgcgcgacatcctcggcggcatctgcgacatcggc
ctggccaacgcctactacgtgggccacatgaagaacgccgagccgggcaccgacgcccgc
aagtggggcgacgccatcaaggtagtgcgcccgaccttcgccaccgccaaggatggcggc
acccacgtcaacatcagcggcgccgcggtcgcggcgcacgcgcccaacaaggccaacgcc
gtcaagctgctggagtacctggtctccgagccggcccagacgctgtacgcccaggccaac
tacgagtacccggtgcgcgccggcgtcaagctggacgcggtggtggccagcttcggcccg
ctgaaggtcgataccctgcccgtggccgagatcgccaagtaccgcaagcaggccagcgaa
ctggtcgacaaggtgggcttcgacaactga

DBGET integrated database retrieval system