KEGG   Bordetella bronchiseptica S798: BBS798_4506Help
Entry
BBS798_4506       CDS       T03637                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
bbx  Bordetella bronchiseptica S798
Pathway
bbx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBS798_4506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbx02000]
    BBS798_4506
Transporters [BR:bbx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BBS798_4506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_16 AAA_21 AAA_29 Mg_chelatase AAA_23 RsgA_GTPase ATP-synt_ab AAA_24 NACHT AAA_18 MeaB
Motif
Other DBs
NCBI-ProteinID: BAO71231
UniProt: A0A5A4MG12
LinkDB All DBs
Position
4883279..4884970
Genome map
AA seq 563 aa AA seqDB search
MTATHPASSAAPLLSIQDLSIALPAGGDRPYAVRNISFDINAGEILCIVGESGSGKSMSA
NAIMGLLPHYLRPEGGRILFDNRDLLSLDESTLRGMRGREMAMIFQEPLSALNPLLTVGE
QIEEVMRVHNAYPEQERAQRVLDVLEFVGLPEPRLIRHAWPFRLSGGQRQRVMIAMALVL
EPRLLIADEPTTALDVTTQAQILELIARIQRQKGMGVMFVTHDFGVVAEIADRVAVMEKG
ILVEEGTADQVLNRPRHPYTQRLIAAVPTQRTGGDASPAAAFSPVLHVRNLKKTYAAAGG
LFHKKRVVHAVNDVSFTVGRGQTVGIVGESGSGKSTIGKCLLKLIDIDGGQMLFEGKDIA
PLTEAQFRPQRRKIQMIFQDPFASLNPRHTVGRILCDGPMAGGAPRQQAEKRARELLRLV
ELDPSAFDRYPGEFSGGQRQRIGIARALAMDPQLIVADESVSALDVSVQAQVLKLLREVQ
QRLQLALIFITHDLRVASQICDHLLVMHRGKVVEQGPPTQIFDDPQDPYTRQLIAAMPGR
DWDPAAAALAQAADEPALYPQPC
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctacccatccagcctcgtccgccgcgccgctgctttccatccaggacctcagc
atcgcgctgcccgccggcggcgaccgcccgtacgcggtccgcaatatctcgttcgacatc
aacgcgggagaaatcctctgcatcgtcggcgaatccggctcgggcaaatccatgagcgcc
aacgccatcatgggcctgctgccgcactacctgcgccccgagggcggacgcatcctgttc
gacaaccgcgacctgctctcgctggacgaatccacgctgcgcggcatgcgcgggcgcgaa
atggccatgatcttccaggaaccgctgtcggcgctgaacccgctgctgaccgtcggcgag
cagatcgaggaagtcatgcgcgtgcacaacgcctatccggaacaggagcgcgcgcagcgc
gtgctcgacgtgctggagttcgtcggcctgcccgagccccggctgatccggcacgcctgg
cctttccgcctgtccggcggccagcgccagcgcgtcatgatcgccatggcgctggtgctc
gaaccccggctgctgatcgccgacgagcccaccaccgcgctggacgtcacgacccaggcg
cagatcctcgaactgatcgcccgcatccagcgccagaaaggcatgggcgtgatgttcgtc
acccacgacttcggcgtggtggccgaaatcgccgaccgcgtggcggtgatggaaaaaggc
atcctggtcgaggaaggcacggccgaccaggtgctcaaccggccgcgccatccgtacacg
cagcggctgatcgccgcggtgcccacccagcgcaccggcggcgacgcaagcccggccgcg
gcgttcagcccggtgctgcatgtgcgcaacctgaagaagacctacgccgccgccggcggg
ctgttccacaagaagcgcgtcgtgcacgccgtcaatgacgtcagcttcaccgtgggacgc
ggccagacggtcggcatcgtgggcgaatcgggttcgggcaaatccaccatcggcaagtgc
ctgctcaagctgatcgacatcgacggcggccagatgctgttcgaaggcaaggacatcgcg
cccctgaccgaggcgcagttccggccgcagcggcgcaagatccagatgatcttccaggat
ccgttcgcctcgctcaacccgcgccacacggtgggccgcatcctgtgcgacggccccatg
gcgggcggcgcgccgcgccagcaggccgaaaagcgcgcgcgcgaattgctcaggctggtc
gagctggatccgtccgccttcgaccgctatccgggcgaattctccggcggccagcgccag
cgcatcggcatcgcgcgcgcgctcgccatggacccgcagctgatcgtggccgacgaatcg
gtctcggccctggacgtatcggtgcaggcccaggtactcaagctgctgcgcgaggtccag
cagcgcctgcagctggcgctcatcttcatcacgcacgacctgcgcgtggcctcgcagatc
tgcgaccacctgctggtcatgcatcgcggcaaggtggtcgagcaggggccgcccacgcag
atcttcgacgacccgcaggacccctacacgcgccagctgatcgccgccatgcccgggcgc
gactgggatcccgcggccgccgcgctcgcgcaggccgccgacgaacccgccctgtaccca
cagccatgctga

DBGET integrated database retrieval system