KEGG   Bacillus bombysepticus: CY96_00400Help
Entry
CY96_00400        CDS       T03597                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bby  Bacillus bombysepticus
Pathway
bby00473  D-Alanine metabolism
bby00550  Peptidoglycan biosynthesis
bby01100  Metabolic pathways
bby01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CY96_00400 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CY96_00400 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CY96_00400 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bby01011]
    CY96_00400 (ddl)
Enzymes [BR:bby01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CY96_00400 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bby01011]
 Precursor biosynthesis
  Amino acid ligase
   CY96_00400 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHX16584
UniProt: A0A023P1U3
LinkDB All DBs
Position
75550..76635
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENAISPLSLSTEIIPSAASEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYSKVEDKLGYPC
FVKPANLGSSVGINKCKNREELEDAFVEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIIAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgcggtgagcgtattgaaggcgaagtaaca
gatgttgaagctttaaaaatgagcggtgcagaaaatgcgatttctccgttatcattaagt
acagaaattatcccatctgcagcttctgaggagaatgctattgacgttattttcccatta
ctacatggaccaaacggtgaagatggaacggttcaaggactattagaattaatgaatatc
ccttatgtaggaaatggtgttctagcatcatctgctggtatggataaagttgttatgaaa
aacatctttgcagaggctggtttaaaacaagcaaaatatgcatccttcattcgtagtgca
tgggaaaaaaatcgtgaggaagcttattctaaagtagaagataagttaggatatccttgc
ttcgtaaaaccagcgaaccttggttcaagtgttggtattaataagtgtaaaaatcgtgaa
gaacttgaggatgcatttgtagaggcattccaatttgatcgcaaaattattgtagaagaa
aatattgtaggtcgtgaagtagaagttggggtactaggtaatgatgagccgaaatgttca
gttgtaggtgaaatcgttccgaaaaaggacttctatgattataagtcgaaatatatcgat
ggtgatacggcgctaattattccagctgaaatgacagaagaagaatctaatgtaattaag
cgtgatgcaattattgcattccaatcattagacggtgcaggtttaacgcgagctgatttc
ttcttaacgaaagatggagaagtgtatattaacgaagtaaacacaatgccaggatttaca
ccgttcagtatgttccctctattatggcaacatactgggttaccgtatccagaattaatc
gaagagctaattcgtttagcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system