KEGG   Bacillus bombysepticus: CY96_01050Help
Entry
CY96_01050        CDS       T03597                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bby  Bacillus bombysepticus
Brite
KEGG Orthology (KO) [BR:bby00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CY96_01050
Enzymes [BR:bby01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CY96_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHX16679
UniProt: A0A023P242
LinkDB All DBs
Position
complement(211600..213126)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPSEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNPGITHTMIDGAAFKEEVESKDIMAVPTVYLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcaattaatggagaac
gatattttacttaaggtaagcgcaggagacgataacgtatctaaagatatgttagctcta
gtagacgaattagctactatgtcatctaagattacagtagaaaaagttgaattagagaga
acaccaagctttagcgtaaaccgccctagtgaagacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacatcattagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttcttaaccctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaactgtttacctaaacggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggt
gcaagtgcagcaatttacgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggcattgagaacttcatcagcgtaaaaaagact
gaaggtcctaagctagtagcaagccttgaagaacacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttctacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatattgcccacactgt
gacggtccattattcactggaaaagacgtagcagttatcggcggaggtaactctggtatt
gaagcagctatcgacttagcaggtatcgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagagcgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaatcactggtactgataaagtaaatggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgtgccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system