KEGG   Bacillus bombysepticus: CY96_05305Help
Entry
CY96_05305        CDS       T03597                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bby  Bacillus bombysepticus
Pathway
bby00061  Fatty acid biosynthesis
bby00780  Biotin metabolism
bby01100  Metabolic pathways
bby01130  Biosynthesis of antibiotics
bby01212  Fatty acid metabolism
Module
bby_M00083  Fatty acid biosynthesis, elongation
bby_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CY96_05305
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CY96_05305
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CY96_05305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bby01004]
    CY96_05305
Enzymes [BR:bby01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CY96_05305
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CY96_05305
Lipid biosynthesis proteins [BR:bby01004]
 Fatty acid synthase
  Component type
   CY96_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AHX17430
UniProt: A0A023P394
LinkDB All DBs
Position
1033617..1034387
Genome map
AA seq 256 aa AA seqDB search
MELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVRELADTLEGQES
LVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDDLKGEFVDTSRDGFLLAQNI
SAFSLTAVAREAKKVMTEGGNILTLTYLGGERVVKNYNVMGVAKASLEASVKYLANDLGQ
HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARG
VTGENIHVDSGYHILG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaactattacaagggaaaacatttgttgttatgggcgttgcgaaccaaagaagtatt
gcatggggaattgctcgctctttgcataatgcaggtgcaaaattaatattcacatatgca
ggagaacgtttagaaagaaacgttcgtgaattagcggacacattagaaggacaagaatca
cttgtattaccttgtgatgtaacgaatgatgaggaacttacagcttgctttgaaacaatt
aaacaagaagtaggtactattcacggtgtagcacattgtattgcttttgcaaatcgcgat
gacttaaaaggtgagtttgtagatacttctcgcgatggatttttacttgcacaaaatatt
agcgcattctctttaacagctgtagcaagagaagcaaaaaaagtaatgacagaaggcgga
aatattttaacgttaacataccttggcggcgagcgtgttgtgaaaaattataacgttatg
ggtgttgcgaaagcttcattagaagcgagcgtgaaatatttagcgaacgatttaggtcaa
cacggtattcgtgttaacgctatttctgcaggaccaattcgtacgttatctgcaaaaggt
gtaggcgattttaactcaatcttaagagaaattgaggagcgcgcaccacttcgtcgtaca
acaacgcaagaagaagttggcgatacagcagtattcctattcagtgatttagcacgcggt
gtaacaggagaaaacattcacgttgattcagggtatcatatcctaggataa

DBGET integrated database retrieval system