KEGG   Bacillus bombysepticus: CY96_05385Help
Entry
CY96_05385        CDS       T03597                                 

Definition
(GenBank) anthranilate synthase subunit I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bby  Bacillus bombysepticus
Pathway
bby00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby01130  Biosynthesis of antibiotics
bby01230  Biosynthesis of amino acids
bby02024  Quorum sensing
Module
bby_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CY96_05385
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CY96_05385
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CY96_05385
Enzymes [BR:bby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CY96_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AHX17446
UniProt: A0A023P2S6
LinkDB All DBs
Position
1046256..1047674
Genome map
AA seq 472 aa AA seqDB search
MMTKEEFIKQKRERKTFLVITEEEGDSITPISLYRRMKGKKKFLLESSQLHQDKERYSYL
GCNPYGEVKSVGTEVERTIYGRAEKLQGNVLQVLEEVIAPSQVDSPFPFCGGAVGYIGYD
VIRQYENIGADLHDPLNIPEVHLLLYREFIVYDHLRQKLSFVYVCREDDSADYEEVYERM
RVYKEEVLQGEEAEVNAIQSKLSFTSSITEKEFCEMVEIAKEYIRAGDIFQVVLSQRLQS
ECIGDPFGLYRKLRIANPSPYMFYIDFQDYVVLGSSPESLLSVREDKVMTNPIAGTRPRG
KTKREDEEIAKELLGNEKERAEHMMLVDLGRNDIGRVSEIGSVTIDKYMKVEKYSHVMHI
VSEVYGTLRKQMGGFDALAYCLPAGTVSGAPKIRAMEIINELENEKRNVYAGAVGYVSFS
GNLDMALAIRTMVVKDEKAYVQAGAGVVYDSDPVAEYEETLNKARALLEVMK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaaagaagaatttataaaacaaaaaagagagagaaagacatttttagtaatc
actgaagaagaaggagatagcattacgccaatttctttatatagacgtatgaaagggaag
aagaaattcttattagaaagttcacagcttcatcaagataaagagcgttattcttactta
ggatgtaatccttatggagaagtgaaaagcgttggtacggaagtggaacgaacgatttac
ggccgggcagaaaagttacaaggtaacgtactgcaagtgttagaagaagtaatcgcacca
tcacaagtagacagtccatttccattttgcggaggagcagttggttatattggatatgat
gtcattcggcagtatgaaaacattggagcggatttacacgacccattaaatattccggaa
gtacatcttttactatatcgtgagtttatcgtttacgatcatttacgccaaaagttgtcg
tttgtatatgtatgcagggaagatgattcagcagattatgaggaagtatacgaaaggatg
cgagtatacaaagaggaagtgctacaaggagaagaagctgaagtaaatgcaatacaatcc
aaattatcatttacttcttctataacggaaaaagagttttgtgagatggtagaaattgcg
aaagaatatataagagcgggagacatattccaagtcgtactatcacagcgtttacaaagt
gaatgtattggggatccattcgggttataccgaaaacttcgaattgcaaatccatcacca
tatatgttctatatcgattttcaagattatgttgtactcggttcttcgccggaaagttta
ctatcagtaagggaggataaagtgatgacgaatccaattgctggtacaaggccgaggggg
aaaacgaagagggaagacgaggaaatcgcaaaagaactgttaggcaatgagaaagagcga
gcagagcatatgatgcttgtagatcttgggcgaaacgatattggtagagtgagcgaaatc
ggctcggttacgatagataaatatatgaaagtagaaaaatactctcacgttatgcacatt
gtatctgaagtttacggaacattgcgaaaacaaatgggcggatttgatgcgttagcgtat
tgcttaccagcagggacggtttctggagctccgaaaattagagcgatggaaattataaat
gaactagagaatgaaaaaagaaatgtatacgctggtgcagttggatacgttagtttttca
ggaaatcttgatatggcgctcgccattcgaacgatggtcgtaaaggatgaaaaagcatac
gttcaagcaggagcaggagtcgtttacgattcagatccagtagctgaatatgaagaaaca
ttaaataaagcgagagcgcttttggaggtaatgaaatga

DBGET integrated database retrieval system