KEGG   Bacillus bombysepticus: CY96_05940Help
Entry
CY96_05940        CDS       T03597                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bby  Bacillus bombysepticus
Pathway
bby00230  Purine metabolism
bby00240  Pyrimidine metabolism
bby01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CY96_05940
   00240 Pyrimidine metabolism
    CY96_05940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bby03400]
    CY96_05940
Enzymes [BR:bby01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     CY96_05940
DNA repair and recombination proteins [BR:bby03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CY96_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-ProteinID: AHX17551
UniProt: A0A023P317
LinkDB All DBs
Position
1152653..1153621
Genome map
AA seq 322 aa AA seqDB search
MRAVNWNKKEDDFSLMFWKQNIAQFWTEEEIAVSSDKNTWAQLSKEEQIAYKRVLGGLTL
LDTKQGGEGMPLVLVHLENLQAKSVLAFMGAMEEVHAKSYSHIFTTLATEEEIDDIFEWV
DTHPLLEKKAGIITGYYRRLLKPEVTKKELYMAMVASVFLESYLFYSGFFYPLYLAGQGK
LTASGEIINLIIRDESIHGVFVGILAQQIFAELSAEEQQEVQKETQELLMELYEIEMAYT
EEIYTSIGLVEDVNRFVRYNANKGLMNLGLEPKFEEEEINPIVLNGLRTDTKNHDFFSVK
GNGYVKATNVEKLADDDFVFNF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtaaactggaacaaaaaagaagatgattttagtttaatgttttggaagcaa
aatatcgctcagttttggacagaagaggaaatcgcggtatcttctgacaaaaatacttgg
gcacaattatcaaaagaagagcagattgcttataagcgtgtattaggtggtttaacactt
ttagatacgaaacaaggcggcgaaggtatgcctcttgtacttgttcatcttgaaaattta
caagcgaaaagtgtattagctttcatgggtgctatggaagaagtacatgcgaagagttac
agtcatatctttacaacgttagctactgaagaagaaattgatgatatttttgaatgggta
gatactcatccattacttgagaaaaaggccggtattattactggttactatcgtcgtttg
ctaaagcctgaagtaacgaaaaaagagttatacatggcaatggtagcaagtgtgttctta
gaaagttatttattctatagtggattcttctatccgctttacttagctggtcaaggaaaa
ctaacagcaagtggtgagattatcaacttgataattcgtgatgagtcaattcacggcgta
ttcgtcggtattttagcacaacaaatcttcgcagaactttctgcagaagagcaacaagaa
gtgcaaaaagaaacacaagagttattaatggaactatatgaaattgaaatggcctataca
gaagaaatttacacttctatcggtcttgtagaagatgtaaatcgtttcgttcgttacaat
gcgaataaagggcttatgaacttaggacttgagccgaagtttgaagaagaagaaattaac
ccaatcgttttaaatggtttacgtacagatacgaaaaaccatgatttcttctctgtaaaa
ggaaatggttacgtaaaagcaacgaacgttgaaaagttagctgacgatgacttcgtgttt
aacttttaa

DBGET integrated database retrieval system