KEGG   Bacillus bombysepticus: CY96_19745Help
Entry
CY96_19745        CDS       T03597                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bby  Bacillus bombysepticus
Pathway
bby00220  Arginine biosynthesis
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby01130  Biosynthesis of antibiotics
bby01210  2-Oxocarboxylic acid metabolism
bby01230  Biosynthesis of amino acids
Module
bby_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CY96_19745
Enzymes [BR:bby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     CY96_19745
    2.3.1.35  glutamate N-acetyltransferase
     CY96_19745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ DUF555 DUF2102
Motif
Other DBs
NCBI-ProteinID: AHX20149
UniProt: A0A023PC00
LinkDB All DBs
Position
complement(3860034..3861257)
Genome map
AA seq 407 aa AA seqDB search
MIKVASITKLENGSIVTPKGFSAIGTANGLKKEKKDLGAIVCDVPASCAAVYTTNQIQAA
PLQVTKDSITAEGKLQAIIVNSGNANACTGMKGLQDAYEMRALGAEHFGLKENYVAVAST
GVIGVPLPMDIIQKGVATLIPTKKESEAYSFSEAILTTDLITKETCYEMIIDGKKVAIAG
VAKGSGMIHPNMATMLSFITTDAHIEHDVLQTALSQITNHTFNQITVDGDTSTNDMVIVM
ASGLSETRPINMEHTDWETFVCALQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAK
KIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVAINPNTIDITLQSILVLKNSEPQTF
SEEEMKERLQEDEIVINVYLHLGEETGSAWGCDLSYEYVKINACYRT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagcgtctattacaaaattagaaaatggttcgattgtaacgccgaaaggc
ttttcggcaattggtactgcaaatggtctgaaaaaggagaaaaaggatttaggggcaatc
gtttgtgacgtaccagcatcatgtgccgctgtgtatacaacgaatcaaatacaagcagcc
cctttacaagtaacgaaggatagtataacggcagaagggaagttacaagcaattatcgtt
aatagtggaaatgcaaatgcttgtactggaatgaaaggattacaagacgcatacgagatg
cgcgcattaggggcggaacattttggattgaaagaaaattacgttgcagtagcttcaaca
ggtgtaattggtgttccgctgccgatggatataatccaaaagggagttgcaactcttata
ccgacgaagaaagaaagtgaagcatattctttttctgaagcaattttaacgacggatctt
ataacgaaagaaacttgctatgaaatgattattgatgggaagaaagtggcgattgcgggt
gttgcaaaaggttcagggatgattcatccgaatatggcaacgatgcttagttttattacg
acagatgctcatatagagcatgacgtattgcaaacggcattatcccaaattacgaatcat
acatttaatcaaattacggtagatggagatacttctacgaatgatatggtcatcgttatg
gcaagtggattatcagaaacaaggccgataaatatggaacatacagattgggaaactttc
gtatgtgctttacagaaggtatgtgaagatttagcaaagaaaattgcgcaagatggtgaa
ggcgctacaaagttaatcgaagtaaatgtgctaggagctcaaacgaatgaagaggcaaaa
aaaattgcaaagcaaatagtcggttcgagtcttgtgaaaacagcaatacatggtgaagat
ccaaactgggggcgaattattagcagtattggacaaagtgaagtagctattaatccgaat
acaattgacattactcttcaatctatattggtattaaaaaatagtgagcctcaaacattt
tctgaagaagaaatgaaagagagattacaagaagatgaaatagtcattaatgtgtactta
cacttaggagaagagacaggatcagcttggggctgtgacttaagctatgaatatgtgaaa
ataaacgcttgttatcgtacataa

DBGET integrated database retrieval system