KEGG   Bacillus bombysepticus: CY96_22120Help
Entry
CY96_22120        CDS       T03597                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bby  Bacillus bombysepticus
Pathway
bby00020  Citrate cycle (TCA cycle)
bby00480  Glutathione metabolism
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby01120  Microbial metabolism in diverse environments
bby01130  Biosynthesis of antibiotics
bby01200  Carbon metabolism
bby01210  2-Oxocarboxylic acid metabolism
bby01230  Biosynthesis of amino acids
Module
bby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bby_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CY96_22120
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CY96_22120
Enzymes [BR:bby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CY96_22120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHX20594
UniProt: A0A023PDA8
LinkDB All DBs
Position
complement(4295356..4296648)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgagggagatggaattggtcctgatatttgggcagctgcatctcgc
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aacttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcacaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaagccgatttcagaagaagggacaaagcgtctt
gtccgtgctgcaattcaatatgcaattaacgaaaaacgttcttctgttacattagttcat
aaaggaaacattatgaaatttacagaaggtgctttcaaaaactggggttatgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatacgatcgtattgttgaaaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaatggtgactatatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtgactggacatgctatc
tttgaagctacacacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tctgttcttctttcaggtgtattattattagaacacttaggatggaacgaagctgcgaaa
ttagtaactgcttctgttgagaaaacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system