KEGG   Bacillus bombysepticus: CY96_25975Help
Entry
CY96_25975        CDS       T03597                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
bby  Bacillus bombysepticus
Pathway
bby00270  Cysteine and methionine metabolism
bby00330  Arginine and proline metabolism
bby00410  beta-Alanine metabolism
bby00480  Glutathione metabolism
bby01100  Metabolic pathways
Module
bby_M00034  Methionine salvage pathway
bby_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CY96_25975
   00330 Arginine and proline metabolism
    CY96_25975
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CY96_25975
   00480 Glutathione metabolism
    CY96_25975
Enzymes [BR:bby01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     CY96_25975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 NTP_transf_3 Pyr_redox_2 Methyltransf_30
Motif
Other DBs
NCBI-ProteinID: AHX21306
UniProt: A0A023PDV0
LinkDB All DBs
Position
complement(5023062..5023889)
Genome map
AA seq 275 aa AA seqDB search
MELWFTEKQTKHFGITARINRTLHTEQTEFQKLDMVETEEFGNMLILDGMVMTTEKDEFV
YHEMVAHVPLFTHPNPENVLVVGGGDGGVIREVLKHPSVKKATLVEIDGKVIEYSKQYLP
SIAGALDNERVEVKVGDGFLHIAESENEYDVIMVDSTEPVGPAVNLFTKGFYAGISKALK
EDGIFVAQTDNPWFTPELITTVFKDVKEIFPITRLYTANIPTYPSGLWTFTIGSKKHDPL
QVSEERFHEIETKYYTKELHNAAFALPKFVGDLIK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaactatggttcactgaaaaacaaacaaaacattttgggattacggcgcgtattaac
cgcacattacatacggagcaaacagaattccaaaaattagatatggttgaaacggaagag
ttcggaaacatgcttattttagatggcatggttatgacaacagaaaaagatgagttcgtt
tatcatgaaatggtagcgcacgtacctttatttacacatccaaaccctgaaaacgtatta
gttgttggcggcggtgatggcggtgttattcgtgaagtattaaaacacccaagtgtaaag
aaagcaactcttgttgaaatcgatggaaaggtaattgagtactctaaacaatatctacca
tcaattgcaggcgcattagataatgagcgtgtagaagtaaaagtaggagatggcttccta
cacatcgcagagagcgaaaatgaatatgacgtaattatggtagattctactgagccagta
ggaccagcagtaaacttatttacgaaaggtttctacgctggaatctctaaagcgttaaaa
gaagacggtattttcgttgcacaaacggacaacccttggtttacaccagaattaattaca
actgtgtttaaagacgtaaaagagatcttccctattactcgtttatacacagcgaacatt
ccaacttacccaagtggtctttggacgttcacaattggatctaaaaaacatgatccatta
caagtaagtgaagagcgtttccacgaaatcgaaacgaaatactacacaaaagaattacac
aacgcagcgttcgcattaccaaaatttgttggcgatttaattaagtaa

DBGET integrated database retrieval system