KEGG   Bacillus bombysepticus: CY96_28625Help
Entry
CY96_28625        CDS       T03597                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bby  Bacillus bombysepticus
Pathway
bby00250  Alanine, aspartate and glutamate metabolism
bby00410  beta-Alanine metabolism
bby00430  Taurine and hypotaurine metabolism
bby00650  Butanoate metabolism
bby01100  Metabolic pathways
bby01110  Biosynthesis of secondary metabolites
bby01120  Microbial metabolism in diverse environments
bby02024  Quorum sensing
Module
bby_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bby00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CY96_28625
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CY96_28625
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CY96_28625
   00430 Taurine and hypotaurine metabolism
    CY96_28625
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CY96_28625
Enzymes [BR:bby01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CY96_28625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHX21760
UniProt: A0A023PFR8
LinkDB All DBs
Position
pBb:complement(254959..256428)
Genome map
AA seq 489 aa AA seqDB search
MPQDRKAKVQKDAYVRKEIMPDNSQSLPRHMQKELPHEFSVNPLFAREGESVVPRFHIPD
KGMLPETAYQIVHDEIALDGNARLNLATFVSTWMEPAAEQLYAKSFNKNMIDKDEYPQTA
EIEERCVRILANLWHSPSPLTTMGVSTTGSSEACMLGGLALKRRWQNARKNEGKPVDRPN
IVFSSAVQVVWEKFANYWEVEPRYVKISPEHPQLDPQGVLAAVDENTIGVVPILGETYTG
LYEPVAAIAKALDDLQARTGLDIPMHVDAASGGFIAPFLQPDLVWDFQLPRVKSINVSGH
KYGLVYPGLGWIIWREAEDLPEDLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNYLRLG
KSGYYDVQRASQKVALFLSKAIQKMEPFELLSDGSDIPVFAWRLKEGYTSNWNLYDLSRQ
LRVFGWQVPAYPLPPDMEAVTIMRVVVRNGFSMDLAHLFLRNLKQTVSFLDSLDGPMPHD
TKCDNGFHH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggatcgaaaagcaaaagttcaaaaggatgcatatgtaagaaaagagattatg
ccagataattcacaatctctaccgcgtcacatgcaaaaagagctgcctcacgaattttct
gtaaatcctctgtttgcccgcgaaggagaatccgtcgttccgcgctttcatattcctgat
aaaggtatgttaccagaaacagcgtatcaaatcgtccatgatgaaattgctcttgatgga
aacgctcgcctgaatcttgcaacattcgttagcacatggatggagcctgccgcagagcaa
ttatatgcaaaatcattcaacaagaacatgattgacaaggacgaatatccacagacagct
gaaattgaggagcggtgtgtccgcatcttagccaacctctggcattcgcccagccccctt
acgactatgggcgtttcaacaactggatcgtcggaagcatgtatgctcggtggacttgct
ttaaagcgacgctggcaaaatgcacgtaaaaacgaagggaagccagtggatcgtcccaat
attgtgtttagttcggctgttcaggtcgtttgggaaaaattcgcgaattattgggaggtt
gaaccacgctatgtgaagattagcccagaacatccccaattggatcctcagggagtcctc
gcagccgtggatgaaaatacgattggtgtggtaccgattctcggtgaaacttataccggt
ctttacgaaccggttgccgcaattgcgaaagcgttggatgatttacaggcgaggacgggt
cttgacattcccatgcatgtggatgcagcttcgggaggatttatagcaccgtttcttcaa
ccagatttagtctgggattttcaattaccgagggtgaagtccatcaatgtatccggacat
aaatatggattagtctatcctggattgggttggataatttggcgggaagctgaagatctc
cctgaggatctaatcttccgtgtctcctatttaggcgggaacatgccgacctttgccctg
aatttctctcgtcctggtgcacaagtgctcctacaatattacaattacctgcgtttagga
aaaagtgggtactatgatgtacaaagggcttcccagaaagtcgctctttttcttagcaaa
gccattcagaagatggaaccgttcgaacttttgtccgatggttcggatattccggttttc
gcttggcgactaaaagaaggttacacatcaaattggaatctttatgatttatctcgacaa
ttgcgtgtgttcggctggcaagtacctgcctacccattgcctccagatatggaagcggtg
acgattatgcgcgttgtggttcgaaatggattttccatggatcttgcacatttatttttg
aggaacctcaaacagaccgtttcctttctggattcccttgacggacctatgccacatgat
acgaaatgtgataatgggtttcaccactaa

DBGET integrated database retrieval system