KEGG   Borreliella burgdorferi ZS7: BbuZS7_0248Help
Entry
BbuZS7_0248       CDS       T00807                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbz  Borreliella burgdorferi ZS7
Pathway
bbz00564  Glycerophospholipid metabolism
bbz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BbuZS7_0248
Enzymes [BR:bbz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BbuZS7_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACK75166
UniProt: A0A0H3C523
LinkDB All DBs
Position
247892..249454
Genome map
AA seq 520 aa AA seqDB search
MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECALITPIYNVLEIPYYYFGLSYY
HNLMGKEKTTKYKTKLLSKKSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAITLLRTFAE
KGGIALNYTELKKFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEIRRLDDEK
ALNIIKPSQGSHLVVKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDIPIKEIEE
EPKRFEEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAQGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIEQNLIPNRAPTTEDLKLHGYLKKEEAMKIPEP
FRAYGSDFEILKNMEGFDKKIHENLDLNEAQIDFSIKFEQAKTIEDVLARRTRSLPLNPQ
ATIEAAPRVAEIMMEKLNKSEEWKNEQIKNFLEISKKYLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaaacaaaattaaaagatcttgaaaatcaagaatttgatcttata
ataattggagggggcgcaacaggtcttggcattgcggtagacgcaattacaagggggtat
aaagcaatacttatagaaaaatttgattatgcaaaaggaacttcctctagatcaagcaaa
ttaattcacggtggagtaagatatttagcccaatggaatatttctttagttaaagaagct
ttgcacgaaaaagccattcttgagaaaaatgcaccccatttaattaacgaatgtgcactt
atcacgcctatttataatgttttagaaataccttattattattttggattaagttactac
cacaatcttatgggtaaagaaaaaactactaaatacaaaactaaattactatccaaaaaa
tctaccattgaaaaagctcccaatattaaaacagagggccttaaatgctctgttctatat
tacgatgattcattcgatgatgctagaatggcaataacattgttaagaacttttgccgaa
aaaggaggcattgcccttaactatacagaacttaaaaaattcaacaaagaaaacggaaag
ctttcgggagttctcatacaaaataaattgtcaaaagaacaaatttcattaaaaagcaaa
tgcataataaacgcaacaggaatattttcagatgaaataagaaggttggatgatgaaaaa
gccttaaacatcattaaaccttcccaaggtagccatttagtagtcaaaaaagacaaattt
cccaaaaatcatgcaatattaatacctaaaactagtgataataggattttattcgctatt
ccttggtatgatagtgttgtttgtggaagcactgacattccaataaaagagatagaagaa
gaacccaaaagatttgaagaagagattgactttataataaataatttaaataactattta
aatattaaaatagaaaaatcagatgtaaaaagtgtatataccggaataagaccattaata
atggatccaaaagctcaaggaaacacttcaaaaatctcaagaaacgaaaaaatatttata
tcagattcaaatcttattacaatagcggggggaaaatataccacatatagaaaaatggcg
gaaaaaaccttgcttaaggccatagaacaaaatttaataccaaatcgtgcaccaactaca
gaagatttaaagttgcacggctaccttaaaaaagaagaagcaatgaaaattcctgaacct
tttagagcttatggcagcgactttgaaattctaaaaaatatggagggttttgacaaaaaa
atacacgaaaacttggatttaaatgaagctcaaatagatttttcaattaaatttgaacaa
gccaaaactattgaggatgttttagcaagaagaacaagatcactacctttaaatcctcaa
gctacaattgaggctgctccaagagttgctgaaataatgatggaaaaattaaataaatct
gaagagtggaaaaatgaacaaataaaaaactttttagaaataagtaaaaaatatttaatt
taa

DBGET integrated database retrieval system