KEGG   Bacillus cereus ATCC 10987: BCE_0439Help
Entry
BCE_0439          CDS       T00162                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bca  Bacillus cereus ATCC 10987
Brite
KEGG Orthology (KO) [BR:bca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCE_0439 (ahpF)
Enzymes [BR:bca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCE_0439 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AAS39375
UniProt: Q73EB9
LinkDB All DBs
Position
complement(453084..454610)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaatatcttcaattaatggagaac
gatattttacttaaagtaagcgcaggagacgatgacgtatctaaagatatgttagctcta
gtagacgaattagctactatgtcatctaagattacagtagaaaaagttgaattagagaga
acaccaagctttagcgtaaaccgccctggtgaagacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacttcattagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttcttaattctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaacagttttcctaaacggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggt
gcaagtgcagcaatttatgcagcacgtaaaggaatccgcactggtatcgttgctgaacgc
ttcggtggtcaagtaatggatactatgggtattgagaacttcatcagcgtaaaacgcact
gaaggtcctaagctagtagcaagtcttgaagagcacgttaaagaatacgacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaaaagcgtaatcgtttcaacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatactgcccacactgt
gacggtccattattcactggaaaagacgtagcagttattggcggaggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaatcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagaacgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaattactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgttccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system