KEGG   Bacteroides caccae: CGC64_01000Help
Entry
CGC64_01000       CDS       T05064                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bcac  Bacteroides caccae
Pathway
bcac00052  Galactose metabolism
bcac00511  Other glycan degradation
bcac00600  Sphingolipid metabolism
bcac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CGC64_01000
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CGC64_01000
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CGC64_01000
Enzymes [BR:bcac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CGC64_01000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ASM64701
LinkDB All DBs
Position
230860..233433
Genome map
AA seq 857 aa AA seqDB search
MKYIVLFQHLQLKNIGLVLLCSFMFSNLLYSQSTREVINFDHGWLFNRYGLQPDGKRIDE
PFGNGSPDSPSPKELAFNDKDWRKLDVPHDWGIEGPFRENLDGYTGKLPWRGIGWYRKRF
NIKNIDKDKMFFLDFDGVMANAEVYLNGKKIGERPYGYISFRVNLTPYIRFDSENIIAVR
VDTEKLGSRWYPGAGIYRHVRLVKTNKLHIPQWGVFISTPEINSQYATASVMVQLANGKK
KTARSSYTIEIFKLDKANIPRERVAVGAKENIKIAANAIDSSLVSLKVEKPQLWDLENTN
LYLAKVSVYDRKTLTDVYDVPFGFRTLKFTHNNGFLLNGKRVQLKGVCMHHDLGALGTAI
NKSAIERQINILKSFGANAIRTSHNPPAPELLELADKMGILILDEVFDCWASGKNENDYA
VHYSEWHKKDIEALVCRDRNHPSVIMWSLGNEVEEQYHPEKGVAAYLRDIVRLYDSTRPV
TFGASYPSKSAINGTELQVDVHGMNYPSGGYGGPDFYETFLNYPGHEHLSGFASESSSTI
SSRGVYFPKGYQVTSYDLKAPGWASLADAEFAALDKYPAICGEFVWTGFDYLGEPTPFNS
DMSVLLNHAALSEEELAKAKEELKRIEKERPSSRSSYFGIVDLAGFPKDRYYLYKAHWMP
DEPMAHILPHWNFPDRIGKITPVFVYSSGDEVELFLNGESLGRKKKEQYQYRFKWENVIY
TPGELKAIAYKNGKLWATESVRTTGEPALLQVSAYKDKIKVADNELAFITVSIRDKTGSV
VPTANHKIKCKLEGEGKIVATDNGDPTSLISFSATERETFNGFMLVVIKAHQGAKGKLRL
IVESENLKSASVDINLL
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgttctttttcagcatctccagttgaagaacatagggctagtcttacta
tgctcctttatgttttccaacctgctatactcccaatcgacgagagaagtcatcaacttc
gatcacggctggctattcaacagatacggtctacagcctgatggtaaacgaatagatgag
ccttttgggaatggcagtccggattctccatctcctaaagagttagcctttaatgacaaa
gactggaggaaattggatgtccctcacgactggggcattgaaggacctttcagggaaaat
ctggatggctatacaggtaagctaccttggcggggaatcggctggtatcgtaaacgcttc
aacatcaaaaatatagataaagataaaatgttttttcttgattttgatggcgtgatggcc
aatgcggaggtatatcttaacggaaagaagataggagaacgtccctatggctacatttcc
ttcagggtaaatcttacgccctatattcgctttgattcggaaaatatcattgcagtcaga
gtggatacggagaaactgggttctcgttggtatcccggagcaggtatttaccggcatgtc
agattggtcaaaaccaacaagcttcatattccccaatggggtgtatttatttctacgccc
gaaatcaatagccaatatgccaccgcatccgtgatggttcagttggctaatggaaagaaa
aaaacggctagaagcagttacacaattgaaatattcaaattagataaagcaaacattccc
cgagaaagagttgcagtgggagctaaagagaatatcaaaattgcagcaaacgccatcgac
agtagcttagtatctctgaaagtggagaaaccacaattatgggatttggaaaatacgaac
ctctatctagccaaggtatcagtatacgatagaaagacgttgacagatgtatacgatgtg
ccgttcggtttccggactttgaaattcacacataacaatggattcctgttaaatgggaaa
agagttcaattgaagggagtatgtatgcatcatgatttaggtgcattaggtacagcaatc
aacaagagtgccatagaacgccaaatcaacatattgaagagttttggcgctaatgctata
cgtacctctcacaacccacccgcacccgagttgttagaacttgctgacaaaatgggaata
cttattctcgatgaagtatttgactgttgggctagtggcaaaaacgaaaatgactacgct
gttcattattccgaatggcataaaaaggacattgaagcacttgtttgcagagacagaaat
catccttccgtcattatgtggagtttgggaaatgaagtagaagaacagtatcatcccgaa
aaaggagtagcagcatatctcagggatattgtgcggctttacgactcaacccgccccgtc
actttcggtgcctcatatcccagtaaaagtgctatcaatggtacagaactccaagtagat
gtccatggcatgaactatccttcgggggggtatggcggtcctgatttttatgaaacattt
ctcaactatccggggcatgaacacttatcaggctttgccagtgaatccagttcaacaata
agttcacgcggagtttattttccaaaaggttatcaagttacttcatatgacttgaaagcc
cccggttgggcatctcttgccgatgccgaatttgctgcattagacaaatatccggctatt
tgtggtgaatttgtctggacgggatttgactatctaggcgaaccgactcctttcaatagc
gatatgagcgtcttactcaaccatgccgcgctcagtgaagaagaactggctaaagcaaaa
gaggaactaaagagaatagaaaaagagcgtccttcctctcgtagcagctattttggcatt
gtcgatctagcaggttttccaaaagatcgttattacttgtataaagcacattggatgccc
gacgagcctatggcacatattctcccccattggaattttccggataggataggtaaaata
actcctgtgtttgtgtattcttcgggcgatgaagttgaactctttctgaatggtgaatct
ttgggcaggaaaaagaaagaacagtatcaatatagattcaaatgggagaatgttatatac
actcccggagaattaaaggccattgcctacaaaaatggcaaactctgggcaacagaaagc
gtaagaaccacaggagaaccggctttgttacaagtctccgcctataaagacaagataaaa
gtagctgacaatgaactggcttttatcacagtctccatccgtgacaaaacaggaagtgtt
gtaccaacggccaatcataagattaaatgcaaattagaaggtgaaggtaagattgtagca
acggataatggtgatccaacttcactcatctctttttcagcgacagagcgcgaaactttt
aacggattcatgttagttgttataaaggctcatcaaggagcaaaaggaaaactacgtcta
attgtggaatccgagaatttgaaaagtgcctctgtggatatcaacctattataa

DBGET integrated database retrieval system