KEGG   Bacteroides caccae: CGC64_02455Help
Entry
CGC64_02455       CDS       T05064                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcac  Bacteroides caccae
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CGC64_02455 (ahpF)
Enzymes [BR:bcac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CGC64_02455 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 Thi4 FAD_oxidored AlaDh_PNT_C DAO NAD_binding_7 FAD_binding_3 NAD_binding_8 PALP Glutaredoxin K_oxygenase Lycopene_cycl PLD_C
Motif
Other DBs
NCBI-ProteinID: ASM64933
LinkDB All DBs
Position
complement(562644..564194)
Genome map
AA seq 516 aa AA seqDB search
MLESALKEQLKGIFAGLEANFTFDISVSSSHENRTELVELLGDVADCSDHITCVVNEGSG
LKFALLKNGDRTGITFRGIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKALKGPIHL
VTYVSLTCTNCPDVVQALNAMTTLNSSITHEMVDGALYQDEVDALKIQGVPSVFADGKLL
HVGRGEFGELLAKLEEQYGIDETKAVAEVKEYDVIVAGGGPAGVSAAIYSARKGLRVAIV
AERVGGQVKETVGIENLISVPETTGSELADNLKTHLLRYPVDLLEHRKIEKVEILGKQKL
VTTSVGEKFLAPALIIATGASWRRLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVFEFMDELKADNVLQERLKSLPNVEVFVCSQTTEVVGNGDKL
TALRIKDRKTEEERLVELDGVFVQIGLSANSSAFREVVETNRPGEIVIDAHCRTNVTGIY
AAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGVI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatctgcattaaaagaacaactgaagggtatttttgccggactggaggcgaat
tttacttttgatatatcggtatcatccagtcatgaaaacagaactgaactggttgaactg
ctgggagacgtagcagactgctccgaccacatcacttgtgtagtgaatgaaggaagcgga
ctgaaatttgctttattgaagaacggtgaccgtactggaatcactttccggggaatcccc
aacgggcacgagtttacttcgctattgttggctatactgaatttggacggcaaagggaag
aacttccccgatgaggctgtctgcaatcgggtgaaagcactgaaaggcccgatacatctg
gttacctacgtttcgctgacttgtacgaactgccctgatgttgtacaggctttgaatgcg
atgacaacactcaattcttccattacgcatgaaatggtggatggtgcgctctaccaggac
gaagtagatgcattgaagatacagggagtgccttccgtgtttgctgacggcaaattgctc
catgtaggccgtggcgaattcggcgaactgcttgcaaaattggaagaacaatatggaatt
gatgaaaccaaagcggtggctgaggtgaaagaatatgatgtgattgttgccggtggaggc
cctgcgggagtgtcggctgctatctattctgcccgtaaaggattgcgtgtagctattgta
gccgaacgtgtcggcggacaagtgaaagagactgtcggcatcgaaaacctaatctctgtt
cctgaaacaacgggcagcgaactggcagataacctgaaaactcacttgttgcgttatccg
gtggatctgttggaacatcgtaagatagagaaagtggaaatactgggaaagcagaaactg
gtaacgacttctgtcggtgaaaagtttctggctcctgcattgattattgcgaccggtgca
agctggcgtaggctgaacgttccgggagaagcggagtatatcggtcgcggtgttgctttc
tgtcctcactgtgacggcccgttctacaaaggaaagcacgtagcggtagttggcggagga
aattccggaatcgaggcggctatcgacttggcaggtatttgttctaaagtaacagtcttt
gaatttatggatgaactgaaagcggataatgtacttcaggaacgccttaaatcattgccg
aacgtagaagtatttgtctgctcacaaactaccgaggtggtaggaaacggtgacaaactg
actgctttgcgtatcaaagaccgcaaaacggaagaagaacgtctggtggaacttgacgga
gtgtttgtacaaatcggcctttctgccaatagtagcgcattccgcgaagtggtggaaaca
aatcgtccgggtgaaattgtgattgacgcacattgtcgcaccaacgtgaccggaatctat
gcagccggagatgtttccaccgtaccttataagcaaatcattatctctatgggagaaggg
gcgaaagctgcactttccgcctttgatgacagagtacgcggcgttatttga

DBGET integrated database retrieval system