KEGG   Bacteroides caccae: CGC64_05440Help
Entry
CGC64_05440       CDS       T05064                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcac  Bacteroides caccae
Pathway
bcac00473  D-Alanine metabolism
bcac00550  Peptidoglycan biosynthesis
bcac01100  Metabolic pathways
bcac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGC64_05440
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGC64_05440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CGC64_05440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcac01011]
    CGC64_05440
Enzymes [BR:bcac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CGC64_05440
Peptidoglycan biosynthesis and degradation proteins [BR:bcac01011]
 Precursor biosynthesis
  Amino acid ligase
   CGC64_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A ATPgrasp_ST ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: ASM65456
UniProt: A0A174W3S8
LinkDB All DBs
Position
1411121..1412095
Genome map
AA seq 324 aa AA seqDB search
MKRNIAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGRRWEVQLPDGNKVPVD
RNDFSFMNGTEKVVFDFAYITIHGTPGEDGRLQGYFDMMRIPYSCCGVLAAAITYDKFAC
NQYLKAFGVRIAESLLLRQGQSVSDEDVLEKIGLPCFIKPSLGGSSFGVTKVKTKEQIQP
AIVKAFGEAEEVLVEAFMEGTELTCGCYKTKEKSVVFPPTEVVTHNEFFDYDAKYNGQVD
EITPARISDELTDRVQMLTSAIYDILGCSGIIRVDYIVTAGEKINLLEVNTTPGMTATSF
IPQQVRAAGLEIKDVMTDIIENKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaacattgctatcgtagcaggaggggatacctctgaaatcgtagtttccctg
cgtagtgcacagggcatttactcctttattgacaaggaaaagtataatttgtacatcgta
gagatggagggccgtcgctgggaggtacaattaccggacggaaataaagtaccggtagac
agaaatgactttagttttatgaacggaacggaaaaggttgtgttcgattttgcttatatc
accattcacggtacgccgggtgaggatggacgtttgcaaggttatttcgatatgatgcgt
attccgtattcttgttgtggagtgttggcagctgccattacctatgataagttcgcttgc
aatcaatatctgaaagcctttggagtgcgtattgccgaatcattgttattgcgtcaggga
caatcggtgtccgacgaggatgtcttggaaaagattggtttgccttgctttatcaaacca
agtctgggtggctccagttttggagttacgaaggtgaagacgaaagaacaaatccaaccg
gctattgttaaagctttcggtgaggcggaagaagtgcttgtggaagcttttatggaaggt
acggaattgacttgcggttgttataaaaccaaggaaaagtcagtggtttttccgcctacg
gaagtagtgactcataatgagtttttcgattatgatgctaaatataatgggcaggtagac
gagataactcctgcacgcatttcggacgaactgaccgaccgggtgcagatgttgacttcg
gctatctatgatatattgggttgttccggcattatccgtgtggattatattgttacagcc
ggtgaaaagattaatcttcttgaagtgaataccactccgggaatgactgcgacaagtttt
attccccagcaagtacgtgctgccggtctggagataaaggatgtgatgactgatattatc
gaaaataaattttaa

DBGET integrated database retrieval system