KEGG   Bacteroides caccae: CGC64_07020Help
Entry
CGC64_07020       CDS       T05064                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcac  Bacteroides caccae
Pathway
bcac00473  D-Alanine metabolism
bcac01100  Metabolic pathways
bcac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CGC64_07020
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CGC64_07020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcac01011]
    CGC64_07020
Enzymes [BR:bcac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CGC64_07020
Peptidoglycan biosynthesis and degradation proteins [BR:bcac01011]
 Precursor biosynthesis
  Racemase
   CGC64_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ASM65734
LinkDB All DBs
Position
1768425..1770917
Genome map
AA seq 830 aa AA seqDB search
MSYTIESIAECIGARRVGECEATIDWLLTDSRSLSFPEETLFFALTTKRNSGARYIPDLY
DRGVRNFVVTEEDFEKFKNGELGKLSTLNFLIVANPLKALQKLAEIHREEFKIPIIGITG
SNGKTIVKEWLHQLLSPDRRIVRSPRSYNSQIGVPLSVWQLNEEAELGIFEAGISEMGEM
NALKRMIKPTIGILTNIGGAHQENFFSLQEKCMEKLTLFKDCDVVIYNGDNELISNCVAK
SMLTAREIAWSRKDIERPLYISRVTKKEDHTVISYRYLDMDNTFCIPFIDDASIENVLNC
LAACLYLMTPADQITERMARLEPIAMRLEVKEGKNNCVLINDSYNSDLASLDIALDFLVR
RSEKKGLKRTLILSDILETGQSTATLYRRVAQLVRSRGIDKLIGVGAEISSCTARFDDAL
ERYFFPNTEALLASNLLKSLHSEVILIKGSRVFNFDLLSEELELKVHETILEVNLGAMVE
NLNHYRAMLRHPETKVICMVKASAYGAGSYEIAKTLQEHHVDYLAVAVADEGSELRKAGI
TSSIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGITNFPIHVKLDTGMHRL
GFGIDEIPLLIRRLKAQNAVIARSVFSHFVGSDSPQFDSFTRQQIELFEKGSQELQAAFS
HKILRHICNTAGIERFPGAQFDMVRLGIGLYGVSPIDNSIIHNVSTLKTTILQIRDVPAE
DTVGYSRKGHLERPSRIAAIPIGYADGLNRHLGRGNAYCLVNGKKAPYVGNICMDVCMID
VTDIDCREGDQAIIFGDDLPITVLSDKLDTIPYEVLTSISTRVKRVYYQD
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatacgattgaatccatagccgaatgtatcggtgcccgccgtgtgggcgaatgt
gaagcgacaattgattggctactgacagacagccgctctcttagtttcccggaagaaact
cttttctttgccctgactacgaaacgtaacagtggagcccgctatatccccgatttatat
gaccggggagtgcgtaattttgtggttactgaagaagactttgagaaatttaagaatgga
gaactaggaaagctctccaccctcaatttcctcatcgttgccaatccgttaaaggctttg
cagaagctggctgaaatacatcgggaggagtttaaaattccgattatcggtataacaggg
agcaatggaaagacgattgtgaaagagtggttacaccagttactgagtcccgaccgtcgt
attgtccgttcgccgcgtagctataattcacagattggtgtacctttatcggtctggcaa
ctgaatgaagaagcagaattgggcatattcgaagccggtatttctgaaatgggagagatg
aatgctttgaagcggatgataaagccgactattggcattctgactaatattggcggtgct
catcaggaaaacttcttctcattacaggagaagtgcatggagaaactgactctttttaaa
gattgtgatgtcgtaatttataacggagataacgaacttatcagcaattgtgtagcaaag
tcgatgttgacagctcgtgaaatagcatggagccgtaaggatattgaacgtccgttatat
attagccgggtgactaagaaagaagatcatactgttatttcctaccgttatctggatatg
gataatactttctgcatcccgtttattgatgacgcttccatagagaatgtactgaactgt
ctggcagcctgcctctatttaatgacccccgccgatcagataacagagcgtatggcacgt
cttgaaccgattgccatgcgtttggaagtaaaagaaggaaagaacaattgtgtattgatt
aatgatagttataactcggacttggcttcattggatatcgctcttgattttttggtacgt
cgttcggagaagaaaggattgaaacgtacattaatcttgtcggatattttagaaacagga
caaagtaccgctacactttatcgtcgtgtggcacagttggtacggagtcgtggaatagac
aaactgattggcgtaggagcagagatttcttcctgtaccgctcgttttgacgatgcgttg
gaacgttatttcttcccgaatacagaagctcttctggcttcgaatctgctgaaatcactt
cattcggaagtaattctgattaaaggttcccgtgtgttcaactttgatctgctgtccgaa
gaactggaactgaaagtgcatgaaacgattctggaagtaaatctcggtgcaatggtggag
aacctgaatcattatcgtgcgatgcttcgtcatcccgaaacgaaagtgatctgcatggta
aaggcttccgcttatggagccggttcgtatgaaatagccaagacattacaggaacatcat
gtcgattatctggctgtagccgtagccgatgaaggttccgaacttcgtaaagcaggtatt
acttcttctatcatcataatggaccctgagctcacagcattcaagactatgttcgactat
aagctggagccggaagtttataatttccacctgctcgatgctttgattaaagcagccgag
aaagaaggaatcaccaacttccctattcatgtaaaattggatacgggtatgcatcggcta
ggttttggcattgatgagattcccttgctgattcgtcgcttgaaagctcagaacgctgtg
attgcccgttcggtgttctctcattttgtaggtagtgattcgcctcaattcgattctttt
acacgtcagcagatagaattatttgagaaaggttcgcaggagttgcaagccgctttctca
cataagattctgcgtcatatctgtaatacggcaggaatcgaacgtttccccggtgcacag
tttgatatggtacgtttgggaatcggactttatggagtgagtccgatagataattcgatt
atacacaatgtaagtactctcaagacaacgattcttcagattcgggacgtgcctgcagaa
gatacggtaggatatagccgaaagggacatttggaacgtccttcacgcattgctgctatt
cctatcggctatgcggacggattaaaccgccatttgggacgtggaaacgcttactgtctg
gtgaatggaaaaaaagcgccttatgtcggcaatatctgtatggatgtttgtatgattgat
gtaacggacatcgactgccgtgagggtgaccaggcgattatcttcggtgatgatcttccg
attactgtcctttctgataaactggatacgattccttacgaagtgttgactagtatatcc
actcgggtaaagcgggtttattatcaggattag

DBGET integrated database retrieval system