KEGG   Bacteroides caccae: CGC64_07740Help
Entry
CGC64_07740       CDS       T05064                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
bcac  Bacteroides caccae
Pathway
bcac00500  Starch and sucrose metabolism
bcac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGC64_07740
Enzymes [BR:bcac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CGC64_07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 HC2
Motif
Other DBs
NCBI-ProteinID: ASM65861
LinkDB All DBs
Position
1982342..1983793
Genome map
AA seq 483 aa AA seqDB search
MRTICLYFEIHQIIHLKRYRFFDIGNDHYYYDDYANETGMNEVAERSYLPALSTLIEMAK
SSGGAFKVALSISGVALEQLEIHAPAVIDLLHQLNDTGCCEFLCEPYSHGLSSLANEDCF
REEVLRQRDKMKQMFGKEPKVFRNSSLIYSDEIGGLVASMGFKGMLTEGAKHVLGWKSPH
YVYHCNQAPSLKLLLRDFKLSDDISLRFSNSDWAEYPLFADKYINWIDVLPQEEQVINIF
MELSALGMAQPLSSNILEFLKALPECARAKGITFSTPTEIVTKLKSVSQLDVPYPMSWVD
EERDTSSWLGNVLQREAFNKLYSVAERVHLSDDRRIKQDWDYLQASNNFRFMTTKNTGIW
LNRGIYDSPYDAFTNYMNILGDFIKRVNSLYPEDVDSEELNSLLTTIKNQGDEITELQKE
VAKWQAKAEKETAAKKTAAKKSVVAKESVVKKEPAAKKSATKKTAESKKAVGRAKKTVTK
KEE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatctgtctttattttgaaatacatcaaattatccatttgaaacgttatcgt
ttcttcgatatcggtaatgatcattactattatgatgactatgcgaatgaaacaggtatg
aatgaagttgctgaacgttcatatctccctgcccttagtacattgattgagatggcgaaa
agttcgggcggtgctttcaaggtagcgctttctatctcgggagtagctttggaacagctt
gaaatccatgctccggcggtcattgatttattgcaccagttgaatgatacaggatgttgt
gaattcctttgtgaaccatattcacatggcttatcatcactggccaatgaggattgtttt
cgcgaagaagtacttcgccagcgtgataagatgaagcaaatgtttggtaaagaaccgaaa
gtattccgtaattctagcttgatttattccgatgaaatcggtggcttggtagcttctatg
ggctttaaggggatgttgacggaaggggcaaaacatgtgttgggctggaagagtccgcat
tatgtatatcattgtaaccaggcacctagtcttaaattgttgttgagggacttcaaactt
tcggatgatatcagtctgcgtttctctaattcggattgggcggaatatcctttgtttgct
gataaatatatcaactggattgatgtgctaccgcaagaagaacaagtaatcaatatcttt
atggaattgagtgctcttggtatggctcaaccattgtcttccaatattcttgaattcctg
aaagcattgccggaatgtgcgagagctaaaggaattactttctctacaccgactgagatt
gtaacgaagttgaaatctgtttctcaacttgatgttccttatccgatgtcatgggtagat
gaggaaagagatacgagcagttggctgggtaatgttcttcaacgtgaagcttttaataaa
ctatatagcgttgccgaacgtgtgcatttgagtgacgatcgccgtatcaagcaggactgg
gattatttgcaggctagtaataacttccgttttatgacaacgaagaatacaggtatctgg
ttgaatcgtggtatctatgactctccttatgatgcttttaccaactacatgaatatctta
ggtgactttatcaaacgagttaattctttgtatcctgaagatgtggatagtgaagaactt
aattctcttttgactactattaagaatcagggtgatgagattactgaattgcagaaagaa
gtagctaagtggcaagcaaaagccgaaaaggaaacggctgctaaaaaaactgcggccaag
aagtctgttgtggcaaaagagtcggtggtaaagaaagaacctgctgcaaagaaatcagcg
accaagaaaactgctgaatcaaagaaagcggtcggacgggccaagaagactgttacaaag
aaagaagaataa

DBGET integrated database retrieval system