KEGG   Bacteroides caccae: CGC64_13315Help
Entry
CGC64_13315       CDS       T05064                                 

Definition
(GenBank) D-xylose transporter XylE
  KO
K08138  MFS transporter, SP family, xylose:H+ symportor
Organism
bcac  Bacteroides caccae
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcac02000]
    CGC64_13315
Transporters [BR:bcac02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    CGC64_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 Imm17
Motif
Other DBs
NCBI-ProteinID: ASM66837
UniProt: A0A413J410
LinkDB All DBs
Position
3245438..3246892
Genome map
AA seq 484 aa AA seqDB search
MINTTNEGSKLYLYSITSVAILGGLLFGYDTAVISGAEKGLEAFFLSASDFQYNKVMHGI
TSSSALTGCVLGGAFSGIFASRLGRRNSLRLAAVLFFLSALGSYYPEFLFFEYGKPNMDL
LVTFNLYRVLGGIGVGLASAVCPMYIAEIAPSNIRGTLVSCNQFAIIFGMLVVYFVNYLI
MGDHQNPIILKDAAGVLSVSSESDMWTVFEGWRFMFGSEAFPAAFFGLLLFFVPKTPRYL
VLVQQDEKAYSILEKINGKTKAQEILNDIKATAHEKTEKLFTYGVAVIVIGILLSVFQQA
IGINAVLYYAPRIFENAGAEGGGMMQTVIMGVVNIIFTLVAIFTVDRFGRKPLLIIGSIG
MAVGAFAVAMCDSMAIKGILPVLSVIVYAAFFMMSWGPICWVLISEIFPNTIRGKAVAIA
VAFQWIFNYIVSSTFPALYDFSPMFAYSLYGIICVAAAIFVWRWVPETKGKTLEDMSKLW
KKNK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgattaatacaacgaacgaaggtagtaaactctacctatattcgataacttctgttgct
atcctgggaggattgcttttcggttatgatacagcagttatttccggtgcagagaagggt
ctggaagcattcttcctttccgcttccgattttcaatataataaagtaatgcatggaatc
acttcatccagtgcattgacaggctgcgtacttggtggggcgttctccggtatattcgct
tcccgtctagggcgtcgtaactccctgagacttgctgccgtactctttttcctttcagca
ttaggttcctattatccggaatttctgtttttcgaatatggaaaaccgaatatggatttg
ctggttacatttaacttatatcgtgttttaggtggtatcggtgtcgggcttgcgtctgct
gtttgtccgatgtatatcgcagaaatagctccttccaacattcgcggaacacttgtttcg
tgcaaccagtttgccattattttcggtatgttggttgtatactttgtgaattacctgatt
atgggcgatcaccaaaatcctattattctgaaagatgctgccggagttttatcagttagc
tcagaatctgatatgtggactgtatttgaaggctggcgttttatgttcggctcggaagct
tttccggctgcattctttggtctattattgttctttgtcccaaaaactcctcgctatttg
gtattggtacaacaagatgaaaaagcttattcaattctggaaaagatcaatggtaagaca
aaagcacaagaaattcttaacgatattaaagctactgctcacgaaaaaacagaaaaactc
tttacttatggagtggcagtaattgttatcggtattctgctttccgtattccaacaggct
atcggcatcaatgcagtgctttactatgctcctcgtatttttgaaaatgcaggtgcagaa
ggaggtggcatgatgcaaacggttattatgggtgttgtgaatattatctttacactggtt
gcaatctttacagtagatcgcttcgggcgcaaacctctgttgataatcggttctatcggt
atggccgtaggtgcatttgcagtagcgatgtgtgatagcatggcaataaaaggaattctt
ccggtactttcggttatcgtatatgccgccttctttatgatgtcatggggcccgatttgc
tgggtattgatttcggaaatcttcccgaacacaattcgtggtaaagcggtggcaatcgct
gtggctttccaatggatattcaattatattgtatcttctactttcccggcattgtacgat
ttcagcccgatgtttgcgtatagtctttatggaattatctgtgtagcggctgctattttc
gtttggcgttgggtgcccgaaacgaaaggtaagacattggaggatatgagcaaactatgg
aagaagaataaataa

DBGET integrated database retrieval system