KEGG   Bacteroides caccae: CGC64_15230Help
Entry
CGC64_15230       CDS       T05064                                 

Definition
(GenBank) YihY/virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
bcac  Bacteroides caccae
Brite
KEGG Orthology (KO) [BR:bcac00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CGC64_15230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Abhydrolase_9_N
Motif
Other DBs
NCBI-ProteinID: ASM67967
UniProt: A0A413MNT3
LinkDB All DBs
Position
3695754..3696686
Genome map
AA seq 310 aa AA seqDB search
MKILAQNKKKLSVSIKIIKDTFQGFIDDNVMRLSASLAYATLFSIIPLLSLLVTIGVLLN
IDFTNQLYAQLEPIVGSKVIDALQAIMENAETTDSFSFATIISIGVTIFGATTVFAEIQS
SLNTIWGIKAVPKKSWLKYIINRLLSFSVILAFAFILLITFTITNLITDISNKFITNNPD
IAESLVKTIGMIINIGVTTVIFTLIFKILPDAKIKSKDVIIGALVTTVLLLIGQWGISFY
IGFANIETVYGAAAFMAIFITWIYYSAIIIYTGAEFTKAWANELGGKIFPDEYAVATKVI
EIREENKPVN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttagcccaaaacaagaaaaagttgtctgtatctattaaaataataaaagat
acttttcaaggatttattgatgacaacgtcatgagattgagcgcgtcactggcttacgca
accctgttctcaatcatccctctgctctcactccttgttactatcggagtattactcaat
atcgatttcaccaatcagttatatgcccaactggaacccattgtcggctccaaagtgatt
gatgcacttcaagcaattatggaaaatgcagagacaaccgattcattttcctttgccacc
attatcagtataggtgtcaccattttcggtgcaacgactgttttcgcagaaatacaaagt
tccctaaataccatttggggaataaaagccgtccccaagaagagctggcttaaatatatc
ataaacagattgctatccttctcggttatccttgctttcgcttttatcctgctaatcacc
tttaccattaccaatcttatcacagatataagcaacaaattcatcaccaacaatccggat
atagcagaatctttggtaaaaacgataggaatgataattaatataggtgtaaccactgtt
atattcactctcatattcaagatattgccggacgcaaagattaaaagcaaagatgtaatt
ataggagcacttgtcactaccgttttattattgatcggacaatggggaatatccttttat
atcggatttgcaaatatagaaaccgtatatggagcggcggcgtttatggctattttcatc
acatggatttattattcagccattatcatatatacaggagcggaatttacgaaagcgtgg
gcaaacgagttaggcgggaagattttcccggacgagtatgccgtagcaaccaaagtcatt
gaaatacgtgaagaaaacaaacctgtcaattaa

DBGET integrated database retrieval system