KEGG   Bacteroides caecimuris: A4V03_00540Help
Entry
A4V03_00540       CDS       T05202                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcae  Bacteroides caecimuris
Pathway
bcae00564  Glycerophospholipid metabolism
bcae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A4V03_00540
Enzymes [BR:bcae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A4V03_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 NAD_binding_8 Thi4 FAD_binding_3 Pyr_redox_3 Pyr_redox 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ANU56244
UniProt: A0A1C7GV80
LinkDB All DBs
Position
159648..161219
Genome map
AA seq 523 aa AA seqDB search
MKRSDLLERMLNWKCECDILVIGGGATGLGAAVDAASRGYRVILLEQHDFAKGTSCRSTK
LVHGGVRYLAQGDVSMVVEALHERGRMRLNAPHLVKDMRFIIGNYRWWEKPFYAVGLTCY
DLLAGRKALGRSLPMLKRSVLKEIPSLKHEGLRGGVVYHDGQFDDSRMAITLALTAIDKG
GVCLNYMKVNCLLKDAAGKINGVHAVDTLDGKEYQIKSKVVVNATGVFVDDVMKMDECDT
RKKVRPSQGVHLVVDSKFLGGRSALMIPKTKDGRVLFGVPWHGKVVLGTTDTPLNEASLE
PRALEEEVDFILDQAGQYLDRKPTRADVLSIFAGLRPLAAPTHADSKKTKEISRNHKIYR
SKSGLLTITGGKWTTYRAMAEDVINQAIVIGGLSPAECVTKNLRVHGYTTEQFDENDWNY
VYGSDADKIQKMIEKEPSFAEKLYEGYTFTAAHVVWAAREEFAQNIEDVLARRVRMLFLD
ARAALEIAPKVASVLAAELGKDKTWEQAQIADFNRLARGYILN
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaagtgatttgcttgagaggatgctcaattggaaatgtgaatgtgatatcttg
gtaatcggtggtggggctaccggattaggggctgcagtggacgcagcctccagagggtac
agagttattctattggaacagcatgattttgctaagggtacttcttgccgcagtacgaag
ctggtacatggaggagttcggtatctggcgcagggagatgtctctatggtagttgaagca
ttacatgaacgtgggcgtatgagactcaatgctcctcatttggtgaaagatatgcgtttt
atcatcggtaattaccgctggtgggaaaagcctttttatgcggtggggctgacttgttat
gatttactggcaggacgcaaagcattgggacgttcgttgccgatgttaaaacgttctgta
ttaaaagaaataccttctttaaagcatgaaggattgagaggcggagtggtatatcatgac
ggacagtttgatgattcgcgcatggctataacgctggcactgaccgctattgataaaggt
ggagtgtgcttgaattatatgaaggtgaattgtttgctgaaagatgccgccggaaaaata
aatggggtgcatgctgtcgatacacttgacgggaaagaatatcagatcaaatcgaaagta
gtagtgaatgctaccggagtttttgtggacgatgtgatgaagatggatgaatgtgatacg
cggaagaaggtacgtcctagccagggagtacatttggtagttgatagtaaattcctgggt
ggtcgttcggcactaatgatacctaaaacgaaagatggacgcgttctttttggagtgccc
tggcacggcaaagtggtgcttggcaccacggatacccctctgaatgaagcttctttggaa
ccgagagcattggaagaagaagttgatttcattttagatcaggcgggtcagtatctcgac
cgcaaaccgacccgtgccgatgtgctttcgatttttgccggtttgcgtcctttagctgcg
ccaacgcatgctgattcgaagaaaacgaaagagatttcacggaatcataaaatctatcgt
tcgaaatcggggcttttgacaattaccggagggaagtggactacttatcgtgcaatggct
gaagatgtcatcaatcaggctatcgtgataggaggattgtctcctgcggaatgtgtgacg
aaaaatttgagggttcatggatatacaacagagcaatttgatgagaatgattggaattat
gtgtatggtagcgacgcggacaaaatacaaaaaatgatagaaaaagaaccttcttttgcc
gaaaagttgtatgaaggttatacttttacagcggcgcatgttgtgtgggcggctcgtgag
gagtttgcgcagaatatagaagatgtgttggcccgccgggtgaggatgctgtttctggat
gcccgtgctgctcttgaaatagctccgaaagtggcatcggtattagcggcggaactggga
aaggacaaaacctgggagcaggcgcagatagccgactttaaccggttggcaagaggatat
atcttgaattag

DBGET integrated database retrieval system