KEGG   Bacteroides caecimuris: A4V03_02100Help
Entry
A4V03_02100       CDS       T05202                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcae  Bacteroides caecimuris
Pathway
bcae00473  D-Alanine metabolism
bcae01100  Metabolic pathways
bcae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4V03_02100
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A4V03_02100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcae01011]
    A4V03_02100
Enzymes [BR:bcae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A4V03_02100
Peptidoglycan biosynthesis and degradation proteins [BR:bcae01011]
 Precursor biosynthesis
  Racemase
   A4V03_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ANU56510
UniProt: A0A1C7GY83
LinkDB All DBs
Position
551439..553979
Genome map
AA seq 846 aa AA seqDB search
MSYTIESIAESIGARRVGKHKANIDWLLTDSRSLSFPEETLFFALTTKRNSGARYIPELY
DRGVRNFVITEEDFKLIENGELQIEKSEQHDSAQPTLNSQLSTLNFLIVPNPLKALQKLA
ETHRDEFKIPVIGITGSNGKTIVKEWLHQLLSPDRCIVRSPRSYNSQIGVPLSVWQLSEE
AELGIFEAGISEMGEMGALKRMIKPTIGILTNIGGAHQENFFSLQEKCMEKLTLFKDCDV
VIYNGDNELISNCVAKSMLTAREIAWSLTDIERPLYISRVTKKEDHTVISYRYLEMDNTF
CIPFIDDASIENALNCLAACLYLMTPADQITERMARLEPIAMRLEVKEGKNNCVLINDSY
NSDLASLDIALDFLVRRSEKKGLKRTLILSDILETGQSTATLYRRVAQLVQSKGINKLIG
VGQEISSCSARFDDDLERYFFPNTEALLASNILKSLHSEVILVKGSRVFNFDLLSEALEL
KVHETILEVNLGAMVDNLNHYRSMLRHPETKMICMVKASAYGAGSYEIAKSLQEHHVDYL
AVAVADEGSELRKAGITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGI
TNFPIHVKLDTGMHRLGFAVEDIPLLIRRLKNQSAVIPRSVFSHFVGSDSSQFDAFTRGQ
IELFEKGSQELQAAFSHKILRHICNTAGIERFPEAQYDMVRLGIGLYGVSPIDNSIIHNV
STLKTTILQIRDVPQEDTVGYSRMGHLVRPSRIAAIPIGYADGLNRHLGRGNAYCLVNGK
KAPYVGNICMDVCMIDVTDIDCREGDQAIIFGDDLPITVLSDKLDTIPYEVLTSISTRVK
RVYYQD
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatacgattgaatccatagccgaaagtatcggtgcccgccgtgtgggcaaacat
aaagcgaatattgattggttgctaacagacagccgctctttgagttttccggaagaaact
cttttttttgctttaactaccaaacgaaatagcggagcccgttatatccccgaactatac
gatcggggcgtacgtaattttgtaattacggaagaagactttaaattaattgagaatgga
gaattgcaaatagagaaatcggagcagcatgatagtgcgcagcccactctcaattctcaa
ctctcaactctcaatttcctcatcgttcccaatcctctgaaagctttgcagaagcttgcc
gaaacacaccgtgatgaatttaaaattcctgtgatcggtatcaccggcagtaatggaaaa
accattgtgaaagagtggttgcatcagttacttagcccggatcgttgtatcgttcgttct
ccacgcagttataattcgcagatcggagttcccctttctgtgtggcaactttctgaagaa
gccgaactgggtatttttgaagccggcatttccgagatgggagagatgggagctttgaaa
cgaatgattaagcctaccattggtattctgaccaatatcggtggtgcccatcaggaaaac
ttcttctctttgcaggagaaatgcatggaaaagctgacgctttttaaagactgtgatgtc
gtgatttataacggtgataacgagttaattagtaattgtgtcgcaaaatcaatgttgacg
gcgcgtgagattgcctggagccttaccgacatcgaacgtccgttgtatatcagccgtgtg
accaagaaagaagatcataccgttatatcttatcgttatctggagatggataatactttc
tgtattccttttatcgatgacgcttccattgaaaatgcactgaattgtctggcagcttgt
ctttacctgatgacacctgccgaccagataaccgagcggatggctcgtctcgaaccgatt
gccatgcgtctggaggtgaaagagggaaagaataactgtgtactgattaatgatagctat
aattcagacttggcatcattggatattgctctcgatttccttgtacgccgctcagaaaag
aaaggcttgaaacggacgcttatcctgtcggatatactggaaaccggacaaagtaccgct
acgctttatcggcgtgtggcacaattggtgcagagtaaaggtattaataaactgattgga
gtagggcaggagatatcttcttgttccgctcgttttgatgatgatctcgaacgctacttc
ttccctaatacagaagcacttcttgcatccaatatactcaaatcgcttcattcggaagtg
atcttggtgaaaggttcccgcgtgttcaactttgatctgttatccgaagcactcgaattg
aaggtacatgaaaccattctcgaagtaaatctcggagcgatggtagacaacttgaaccat
taccgttctatgcttcgccatccggaaacaaagatgatctgtatggtgaaagcatcagct
tacggagctggttcgtatgaaatagccaagagtttgcaggaacatcatgtcgattatctg
gccgtagctgtcgctgacgaaggttccgaactccgcaaggctggcattaccgcttcgatt
atcattatggacccggaacttaccgcattcaaaaccatgtttgattataaactggaaccg
gaagtctataatttccatctgcttgacgcacttatcaaagctgcggagaaagaaggaatc
accaacttccccattcatgtgaaacttgatacaggtatgcaccgtttgggttttgcggtg
gaggatattccattgcttatccgtcgactgaagaatcagagtgcagtgattccccgttcg
gtattctctcattttgtaggaagtgattcgtcgcagttcgacgctttcacccgtggacag
attgaattgttcgagaaaggttcgcaagaattgcaggctgctttctctcataagattctc
cgtcatatctgcaatacggcaggaatcgagcgttttcccgaagcacagtacgatatggtg
cgcttgggaatcggactttatggagtcagcccgatagacaattcgatcatacataatgta
agtacgctcaagaccaccatccttcagatccgggatgttcctcaagaagatacggtagga
tatagtcggatggggcatttggtacgtccttcccgcattgcagctattcctatcggttat
gcggatggactgaaccgccacttgggacgcggcaacgcctattgcctagtgaacggaaag
aaagctccttatgtggggaatatctgtatggacgtttgtatgattgatgtgacggatatt
gattgtcgggaaggcgatcaggctattattttcggtgatgatctgccgattacggtgttg
tccgataagctggatacgattccttatgaagtgttgacaagcatatcgacacgggtgaaa
cgggtatattatcaggattaa

DBGET integrated database retrieval system