KEGG   Bacteroides caecimuris: A4V03_04345Help
Entry
A4V03_04345       CDS       T05202                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bcae  Bacteroides caecimuris
Pathway
bcae00500  Starch and sucrose metabolism
bcae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A4V03_04345
Enzymes [BR:bcae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A4V03_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C Internalin_N
Motif
Other DBs
NCBI-ProteinID: ANU56900
UniProt: A0A1C7GZ99
LinkDB All DBs
Position
1078973..1081132
Genome map
AA seq 719 aa AA seqDB search
MKNMKIGTVIGLCLLLSFFFGTSAKAESITSPDGQLKLNFSVNAQGEPVYELSYKGKEVI
KPSKLGLELKNDPGLMNGFTLIDTKTATFDETWQPVWGEVKSIRNHYNEMAVILNQKAQD
RNLIICFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAGDHTAFWIPGDYDTQEYDY
TESKLSEIRGLLQGAITPNASQTPFSPTGVQTSLQMKTADGLYINLHEAALIDYSCMHLN
LDDQNLVFESWLTPDAKGDKGYMQTPCRSPWRTVIVSDDARDILASKLTLNLNEPCMYED
VSWIKPVKYIGVWWEMITGKGSWSYTDDVYSVKLGQTDYSKTKPNGRHSANNDKVKRYID
FASEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNAYAKEKGVKLMMHH
ETSASVRNYERHLDKAYQFMIDNGYNAVKSGYVGNIIPRGEHHYGQWMNNHYLYAVEKAA
EYKICVNAHEATRPTGLCRTYPNLIGNESARGTEYEAFAGNKPFHTTLLPFTRQIGGPMD
YTPGIFDTKLSFLSGDHSFVRTTLAKQLALYVTMYSPLQMAADLPESYERHMDAFQFIKE
VAIDWDDSKYLEAEPGDYITVARKAKGTDNWFVGGITDENPRTSTFTLDFLEPGKQYVAT
LYADGKDADFEKNPTSYQIKKGLVTNKNKMSVKLARSGGFAVSLIEATPADLKTIRKWK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgaaaataggaactgtaatagggctctgtctgttgctctcttttttcttc
ggcacatcagctaaagccgaaagtatcacttctcctgacggacaattaaaacttaatttc
tctgtcaatgcgcaaggagaaccggtgtacgaactctcttataaaggaaaagaagtaatt
aaaccttcgaaactgggattggaattaaagaatgatccgggactgatgaacggattcacg
ctgatcgatacgaaaactgctacttttgacgaaacatggcaacctgtgtggggagaggtg
aaatccatccgcaaccattataatgaaatggctgtcatcttgaatcaaaaggcacaagat
cgtaatctgattatttgttttcgtctttataacgatggtttgggattccgttatgaattt
ccacagcagaaaaatctgaattacttcgttatcaaagaagaacattctcaattcgctatg
gctggcgatcatacagccttctggattccaggcgattatgatacgcaggaatatgactat
accgaatccaaactttcagaaattcgcggattattgcaaggagcaattactccaaatgct
tctcaaacacctttctctccgacaggtgtacaaacttccctgcaaatgaaaacggccgac
ggattgtatatcaatctgcatgaagccgctttgatcgactattcttgtatgcatctgaat
ctggacgatcagaatctggtttttgaatcatggctgactcctgatgcgaaaggagataag
gggtatatgcagactccctgccgttcaccctggcgtacggtgattgtaagtgatgatgcc
cgtgatattctggcttccaaattgacattgaatctgaatgagccttgtatgtatgaagat
gtttcttggattaagccggtgaaatatattggagtgtggtgggaaatgatcaccggaaaa
ggttcctggtcgtatacggatgatgtttattcggtgaaacttggacagacggattattcc
aaaacaaagccaaacggacgccattcagccaacaatgataaagtgaaacgttatatcgat
tttgcttccgaacatggattcgaccaggtattggtggaaggctggaatgaaggttgggaa
gactggtttggaaaatcgaaggattatgtctttgatttcgtcactccatatcctgatttt
gacgtgaaaatgctcaatgcgtatgctaaggaaaaaggggtgaagctgatgatgcatcac
gagacctctgcttctgtacgtaactacgaacgtcatcttgataaagcatatcagtttatg
atagataacgggtataatgctgtgaaaagtggatatgtaggtaacattattcctcgtgga
gaacatcattacggacagtggatgaataaccattatttatatgcggtagaaaaagctgcc
gaatataagatatgtgtaaatgcccacgaagcaacccgtcccacaggattatgtcgtacc
tacccgaatctgattggtaacgaatcggctcgtggcacagaatatgaagcttttgcaggt
aacaaaccgttccatacgaccttgcttcctttcacccgtcagattggcggaccgatggat
tatacgccgggtatttttgataccaaactatcattcctgtcgggcgatcacagctttgta
cgtactactttggctaagcaattagcgctttatgtaacgatgtacagtcctttgcaaatg
gcagccgaccttccggaaagttacgaacgccacatggatgcatttcaatttatcaaagag
gtagctattgattgggatgacagcaagtatctggaagcagaaccgggagattatattaca
gtggcacgtaaagcaaaaggcactgataactggtttgtaggaggcattactgacgaaaat
cctcgtacttctacttttacgcttgattttcttgaaccgggaaaacaatatgtagccact
ctttatgctgacggaaaagatgcggactttgaaaaaaatccgacctcttaccagataaaa
aaaggattggtgacaaataagaataagatgtctgtgaagttggcacgcagcggagggttt
gcagtaagtctgatagaagcaactcccgccgacttgaaaacaatcaggaaatggaaataa

DBGET integrated database retrieval system