KEGG   Bacteroides caecimuris: A4V03_11350Help
Entry
A4V03_11350       CDS       T05202                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bcae  Bacteroides caecimuris
Pathway
bcae00511  Other glycan degradation
bcae00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bcae00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A4V03_11350
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A4V03_11350
Enzymes [BR:bcae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     A4V03_11350
Bacterial toxins [BR:bcae02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   A4V03_11350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR BNR_6 BNR_4 DUF4185
Motif
Other DBs
NCBI-ProteinID: ANU58084
UniProt: A0A1C7H0I8
LinkDB All DBs
Position
complement(2682802..2683962)
Genome map
AA seq 386 aa AA seqDB search
MKTYKIITCIFLFISMFTQACQKDDETQGNPTPVPPEEEVPSSEFNYIYNQGTDGFELYR
IPAIVKSKSNTLLAFAEARKARSNGDSGDIDLVVKRSSDNGKTWSKQITIWNDGQNTCGN
PVPIVDDRGRIHLLMTWNFQTDKWGAITNGTGEDSRRPYYTYSDDDGITWAQPVEITSSV
KKEKWDWYATGPCHGIQIQKGIHKGRLVAPNYFTTRESGKVTSYSHIIYSDDYGKTWKPG
EPTPVGGVGECSVAEIGEGTLMLNMRADEGFYRKSCTSMDGGLTWSSPQISIDQIDCKCQ
GSILSIGGAVFLSNAASATERINMTIKKSTDNGKNWKGQYTVYEGNSGYSDIVELSDSQI
AIIYEGGEKRYTDGLAFKVVSIKSIQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctataagattattacatgtatatttctttttataagtatgtttacacaagct
tgtcaaaaagatgatgagacacaaggaaacccaactcctgttccaccggaagaagaagtg
ccttcgtccgaattcaactatatttataatcaagggacggatggttttgaactctatcga
atacctgctattgttaaaagtaaaagcaatactttattagcttttgctgaagctagaaaa
gctcgaagtaatggagatagcggagatatagatcttgtagtcaaacgttcgtcggataat
ggaaaaacatggagtaaacagattacgatatggaatgatggacaaaacacttgtggaaat
cccgtgcctattgttgacgacagaggtagaatacatctgcttatgacttggaatttccag
actgataaatggggagcaataaccaatggtaccggagaagacagccgacgtccgtactat
acatattctgatgatgacggcattacttgggcgcaaccagttgaaataacttcttctgta
aaaaaagaaaaatgggattggtatgctaccggtccgtgccatggtattcagattcaaaag
ggaatacataaaggaagattagttgctccaaactattttacaactcgggagagtggaaag
gtcacgagttattctcacatcatttattctgatgattacggaaaaacatggaaaccagga
gaacctactcctgtcggtggtgttggagagtgttctgtagccgagataggagagggaaca
ttaatgttgaatatgagagcagatgaaggcttttatcggaaaagttgtactagcatggat
ggaggacttacttggtcttcacctcaaattagcattgatcaaatagactgtaagtgtcag
ggtagtatattatcaataggaggagctgtttttctttcgaatgctgcttccgctacggaa
cgtattaatatgactatcaaaaaaagtacggataatgggaagaattggaagggacaatat
acagtttatgaaggtaactctggttactctgatatagttgagctctctgattcacagatt
gctattatctatgagggaggagaaaaacgatatacggatgggctggcatttaaagttgtt
agcataaaatcaatacaatga

DBGET integrated database retrieval system