KEGG   Paraburkholderia caribensis: K788_0000151
Entry
K788_0000151      CDS       T04141                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00440  Phosphonate and phosphinate metabolism
bcai00998  Biosynthesis of various secondary metabolites - part 2
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    K788_0000151
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    K788_0000151
Enzymes [BR:bcai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     K788_0000151
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: ALL68839
UniProt: A0A0P0RJ92
LinkDB
Position
2:2796940..2798649
AA seq 569 aa
MNAREPSFVSTLSRSARLRQMLTSNELEFLMEAHNGISARIAREAGFKGIWGSGLAISAQ
YGVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCI
EDKVFPKTNSFIKGEAQPLADIDEFCGKIKAGKDSQTDEHFSIVARVEALIAGWGMDEAL
KRAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFRKAGIS
TVIWANHQIRAATSAMQAVVKEIYESQTLVNVEDRIATVNEIFRLQDADEYSVAEERYLS
SSRVASSAVVLAASRGKGLEAVTTDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGY
RADAIDTAGIKLVVNERHEQTGELASLACAVDGLQNDAVISYGDLLFRSYIVRDLVDSEA
LFSVVVDSTTVAEAGATNQSVRDFAWCSAADDRGLFGNKVLLRRVANNEADVKGEVPNGR
WIGLLNVRGAGRERLQAVMNTLRARPDFDSLDMPALLNALIEAGEEIEVQYVHGHWRGVN
DLEDFRRAGDFAHEATPLAKGDAAGGAAQ
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaaccctcatttgtttccactctgtcgcgcagcgcacgcttgcgccag
atgctcaccagcaacgaactcgagttcctgatggaagcgcacaacggcatctccgcacgc
atcgcgcgcgaagccggcttcaagggcatctggggctcgggccttgcgatctccgcgcaa
tacggtgtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgatacgctcgaattc
atggctgacgcgagcgacctgcccattctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccgcctggtgcgcaagctggagcaacgcggcatcgcgggcgtgtgcatc
gaagacaaggtgtttccgaagacgaacagcttcatcaagggcgaagcgcagccgctcgcc
gatatcgacgagttctgcggcaagatcaaggcgggcaaggattcgcagacggacgagcat
ttctcgatcgtcgcgcgcgtcgaagcgctgatcgccggctggggcatggacgaagcgctg
aagcgcgccgaagcgtatcgccaggcgggtgcggatgcgatcctgatccacagcaagctg
tcgcgccccgacgagattctcgagttcgcgcgcgaatgggcagggcgcggtccgctggtg
atcgtgccgaccaagtactacagcacgccgacggaagtgttccgcaaggcgggcatcagc
acggtcatctgggcgaatcatcagattcgcgcggcgacttccgcgatgcaggctgtcgtc
aaggaaatctacgaaagccagacgctcgtcaacgtggaagaccgcattgcgaccgtcaac
gaaattttccgtctgcaggatgccgacgagtactcggtagcggaagagcgttatctgtcg
tcgtcgcgtgtggcgagttcggccgtggtgcttgccgcgagccgcggcaagggcctggaa
gccgtgacgacggatcgtccgaaggtcatgctgcccatcgcgggcaagccgctgctgcgc
tggctcgtcgacgcgttcaagaagcagggcgtcaacgacatcacggtggtgggcggctat
cgcgccgacgcgatcgacacggcgggcatcaagctcgtggtcaacgagcgtcacgagcag
acgggcgaactggcgtcgctcgcgtgcgcggtcgacggcttgcagaacgacgccgtgatc
tcctacggcgacctgctgttccgcagctacatcgtgcgcgatctggtggatagcgaagcg
ctgttcagcgtggtcgtcgattcgacgacggtagccgaagcgggcgcgacgaaccagagc
gtgcgcgattttgcgtggtgctcggctgccgacgatcgcggcctgttcggcaacaaggtg
ctgctgcgccgtgtggcgaacaacgaagcggacgtgaagggcgaagtgccgaatggccgc
tggatcggtctgctgaacgtgcgcggcgcgggccgcgagcgtctgcaggcggtgatgaac
acgctgcgcgcgcgccccgatttcgattcgctcgacatgcctgcgctgttgaatgcgctg
atcgaagccggtgaagaaatcgaagtgcaatacgtgcatggccactggcgcggtgtgaac
gacctcgaagacttccgtcgcgcgggcgacttcgcgcacgaagcgacgccgcttgcgaag
ggcgatgcagcgggaggcgcggcgcaatga

DBGET integrated database retrieval system