KEGG   Paraburkholderia caribensis: K788_0000735Help
Entry
K788_0000735      CDS       T04141                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00260  Glycine, serine and threonine metabolism
bcai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    K788_0000735
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     K788_0000735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALL68157
UniProt: A0A0N7JV41
LinkDB All DBs
Position
2:complement(2047507..2048535)
Genome map
AA seq 342 aa AA seqDB search
MKALAKLERAPGLTLTRVKKPEVGHNDVMIRITRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA
FAEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAV
AIAKHVGARNVVITDVNDYRLELARKMGATRAVNVSRESLRDVMSDLHMTEGFDVGLEMS
GVPSAFTSMLEAMNHGGKIALLGIPPAQTAIDWTQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPILTHRFAVDDYEQAFATMLSGESGKVILDWTV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactggcaaaactcgaacgcgcaccgggcctcacgttgacccgtgtgaagaaa
ccggaagtgggccacaacgatgtgatgatccgcatcacgcgcacggctatttgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaaaaccattcccgtgccgatgcac
gtcggtcatgaatatgtcggcgaaatcgtcgaaatgggccaggaagtgcgtggcttttcg
atcggcgaccgcgtgtcgggcgaagggcatatcacgtgcggattctgtcgcaactgtcgc
gcgggacgtcggcatttgtgccgcaataccgttggcgtcggcgtgaatcgcgaaggcgcg
tttgcagaatatctcgtgattcccgccttcaacgcattcaagattccgcccgaaatctcc
gacgatctcgccgcgatcttcgatccgttcggcaacgcgacgcacacggcgctgtcgttc
aatctggttggcgaagacgtgctgatcacgggcgcgggaccgatcggcatcatggccgtc
gcgatcgcaaagcacgtgggcgcgcgcaacgtcgtgattaccgacgtcaacgattaccgg
ctggagcttgcgcgcaagatgggtgcgacacgcgccgtgaacgtgtcgcgcgaatcgctg
cgcgacgtgatgagcgatctgcacatgacggaaggcttcgacgtgggcctcgaaatgtcg
ggcgtgccgagcgcattcacgtcgatgctcgaagcgatgaaccacggcggcaagatcgcg
ttgctcggcattccgcctgcgcaaacggcgatcgactggacccaggtcatcttcaagggc
ctcgaaatcaagggcatttatggccgcgagatgttcgagacctggtacaagatggtcgcg
atgctgcaaagcggcctggatctttcgccgattctcacccaccgcttcgccgtcgacgat
tacgaacaggcgttcgcgaccatgttgtcaggggaaagcggcaaggtcatcctcgactgg
accgtctga

DBGET integrated database retrieval system