KEGG   Paraburkholderia caribensis: K788_0001050Help
Entry
K788_0001050      CDS       T04141                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcai00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    K788_0001050
Enzymes [BR:bcai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     K788_0001050
Transporters [BR:bcai02000]
 Other Transporters
  Pores ion channels [TC:1]
   K788_0001050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 zf-NOSIP
Motif
Other DBs
NCBI-ProteinID: ALL67829
UniProt: A0A0N7JV00
LinkDB All DBs
Position
2:1711440..1712111
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPKTMLAPPELRAVHPLGKSPVVTDDG
QTLAESAAILEYLLERYGQGRFEPAAGTPERQTFRYWMHYAEGSAMPPLLLKLVALRIGS
APMPFFAKPIAKKISSTLQSTFIDPQIALHMGFIEDSLRTTGWFAGNEFTAADIQMSFPL
EAATARGNRDVKYPSVARFLDTIHARPAYQRALERGGKYDLLS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccaccacctgaacaactcccgttcgcagcgcgtgctgtggctgcttgaa
gaactgggcgtgccatacgaaatcaagcgttacgagcgcgacccgaaaacgatgctcgcg
ccgcctgaactgcgcgcggttcatcccctcggcaagtcgcccgttgtcacagacgatggt
cagaccctcgctgaatccgctgcgatcctcgagtatctgctcgaacgttatggtcagggc
cgcttcgaaccggctgccggcacgcccgaacgccagacgttcagatactggatgcactat
gcggaaggctcggcaatgccgccgctgttgctgaagctggttgcgctgcgcatcggcagc
gcgccgatgccgttcttcgcgaagccgattgcgaagaagatttcatcgacattgcaatcc
accttcatcgatccgcagatcgcgctgcatatgggttttatcgaagattcgctacgcacg
accggctggttcgcaggcaacgaattcacagccgcggatattcaaatgagcttcccgctc
gaagccgccaccgcgcgcggcaaccgcgatgtgaaatatccgtccgtcgcccgttttctc
gacacgatccatgcccggcccgcttatcagcgcgcgctcgaacgcggcggcaagtacgat
ttattgagctga

DBGET integrated database retrieval system