KEGG   Paraburkholderia caribensis: K788_0002415Help
Entry
K788_0002415      CDS       T04141                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00020  Citrate cycle (TCA cycle)
bcai00310  Lysine degradation
bcai00380  Tryptophan metabolism
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01130  Biosynthesis of antibiotics
bcai01200  Carbon metabolism
Module
bcai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    K788_0002415
  09105 Amino acid metabolism
   00310 Lysine degradation
    K788_0002415
   00380 Tryptophan metabolism
    K788_0002415
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     K788_0002415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: ALL64911
UniProt: A0A0P0R9K4
LinkDB All DBs
Position
1:2248052..2250907
Genome map
AA seq 951 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEELYEAYLDNPASVPETWRNYFDALQNVPASDGTSANDVAH
GPIVESFAQRAKANAFLPRTGGEDLTTARKQVYVQSLIGAYRFLGSQWANLDPLKRRERP
NIPELEPAFYDFTEADMDQTFNTNNLYFGFEQASLRDIVKALRDTYCGTIGAEYMYLSDP
EQKRWWKERLESIRSTPNFTADKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGESFI
ASMDEVVHHAGKSGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGDVK
YHKGFSSDVATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDENGLQVLPVQIHG
DAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCSDVVKMIE
APVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVIDIICFRKLGHNEQDTPAVTQPLMYKT
IAKHPGTRALYAEKLVQQGVITADQGDEFIKAFRKAMDEGHHTVDPVLSNYKSKYAVDWV
PFLNRKWTDAADTAVPLAELKRLAERITTIPEGFKVHPLVERVINDRRAMGRGEAQLDWG
MGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIADGQA
KFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKWGR
VSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQVFHLLRRQMIRLFR
KPLVVFTPKSLLRHKEAVSDLSELAKGSFQPVLSEADDSIDAKKVKRVLVCSGRVYYDLV
AHRREAKAQDVAIVRIEQLYPFAHKQFEAELKKYDNATEVVWVQDEPQNQGPWFYIEHHL
REGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKGASIVK
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcgtatctgttcggcggcaatgctccgtacgtagaa
gagttgtacgaagcatatctcgacaatcccgcgtcagtgcccgagacctggcgcaattat
ttcgacgctctgcagaacgttcctgcatcggatggcaccagtgccaacgacgtggcccat
ggcccgatcgtcgaatcgtttgcgcagcgcgcaaaggcgaatgcctttctgccgcgcacg
ggcggtgaggatctcaccaccgcgcgcaagcaagtctatgtgcagtccctgatcggcgca
tatcgcttcctcggctcgcaatgggccaacctcgatccgctgaagcgccgcgaacgtccg
aacattcccgagcttgaacctgcgttctacgacttcaccgaagccgacatggaccagacg
ttcaacacgaacaacctgtacttcggtttcgagcaggcttcgctgcgggacatcgtcaag
gcgttgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacctgagcgatccg
gaacagaagcgctggtggaaggaacgtctcgaatcgatccgctccacaccgaacttcacg
gctgacaagaagaagcacatcctgaaccgtctgacggcagcagaaggcctcgagcgcttc
ctgcacaccaagtacgtcggtcagaagcgcttctcgctggaaggcggcgaaagcttcatc
gcgtcgatggacgaagtcgtgcaccacgcaggcaagagcggcgtgcaggaaatcgtcatc
ggcatggcgcaccgcggccgtctgaacgtgctggtcaacacgctgggcaagatgcccgcc
gacctgttcgccgaattcgaaggcaagcacgtcgacgatctgcccgcaggcgatgtgaag
taccacaagggcttctcgtcggatgtcgcaacggaaggcggcccggttcacctgtcgctc
gcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggctcggcgaaggcc
cgtatggaccgtcgcggcgacgagaacggcctgcaggtgctgcccgtgcagatccacggc
gacgccgcctttgcaggccagggcgtcgtgatggaaacgctgaacctcgcgcaaacgcgc
ggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggcttcaccacg
tccgacccgcgcgacgcacgctccacgctgtactgctcggacgtcgtcaagatgatcgaa
gcgcccgtgctgcacgtgaacggcgacgatcccgaagctgtcgtgctggctacgcaactg
gccatcgacttccggatgcagttccacaaggatgtcgtgatcgacatcatctgcttccgc
aagctgggtcacaacgagcaggacacgcccgccgtcacgcagccgctgatgtacaagacg
atcgccaagcaccccggcacgcgcgcgctgtacgcggaaaagctggtgcagcaaggcgtc
atcaccgccgatcaaggcgatgaattcatcaaggcattccgcaaggcgatggacgaaggt
caccacacggtcgacccggtcctctcgaactacaagagcaaatacgctgtcgactgggtt
ccgttcctgaaccgcaagtggacggacgcagcggacacggccgtgccgctcgccgaactc
aagcgtctggccgagcgcatcacgacgatccccgaaggcttcaaggttcacccgctcgtc
gagcgcgtgatcaacgaccgccgtgcaatgggccgtggcgaagcgcaactcgactggggc
atgggcgagcatctggcattcgcgtcgctggtcgcatcgggctacgccgtgcgcctgacg
ggtcaggactcgggccgtggcacgttcacgcaccgccacgcggtgctgcacgaccagaac
cgcgaacgctggaacgacggcacgtacgtgccgctgcagaacatcgccgatggtcaggcg
aagttcacggtgatcgactcggtgctgtccgaagaagccgtgctcggcttcgaatacggc
tactcgacggctgagccgaacacgttcgtcgcgtgggaagcgcagttcggcgacttcgtg
aacggcgcacaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtggggccgc
gtgtcgggcctgacgatgctgctgccgcacggctacgaaggccagggtccggagcactcg
tcggcgcgtatcgagcgcttcctgcaactgtgcgcagatcacaacatgcaggtcgttcag
ccgaccacgccggcacaggttttccacctgctgcgccgccagatgatccgcctgttccgc
aagccgctcgtcgtcttcacgccgaagtcgctgctgcgtcacaaggaagccgtgtcggat
ctgtcggaactcgcgaagggctcgttccagccggttctcagcgaagcagacgattcgatc
gacgccaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtactacgacctcgtc
gcgcatcgtcgcgaagcgaaggcgcaagacgtcgcgatcgtgcgtatcgaacagctctat
ccgttcgcgcacaagcagttcgaagccgaactgaagaagtacgacaacgcaaccgaagtg
gtgtgggtgcaggacgagccgcagaatcagggcccgtggttctacatcgaacatcacctg
cgcgaaggcatgaaggaaggacagaagctggcgtacagcggccgtcccgcttcggcttcg
cccgctgtcggctactacgcgaagcactacgagcagcagaaggcgctgatcgaaggcgcg
tttggccgtctgaaaggcgcgtccatcgttaaataa

DBGET integrated database retrieval system