KEGG   Paraburkholderia caribensis: K788_0003532Help
Entry
K788_0003532      CDS       T04141                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00010  Glycolysis / Gluconeogenesis
bcai00620  Pyruvate metabolism
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K788_0003532
   00620 Pyruvate metabolism
    K788_0003532
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     K788_0003532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALL63480
UniProt: A0A0P0R6J6
LinkDB All DBs
Position
1:763893..765413
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLTTEFPFKKQYANFIGGEWVKPVGGEYFDNVSPITGEPFTSIPRSREADIEL
ALDAAHRAKAAWGKTSTTERANILNKIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGTVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVMLELIQDLLPAGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVLDKDDSFFDKALEGFAMFALNQGEV
CTCPSRVLIEESIYDRFMERAVKRVAAIQQGHPLDSKTMIGAQASREQLEKILSYIDLGK
QEGAQCLIGGEQNKLDGELAKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKNEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgcagaaatgaagtttctgacaaccgagttcccgttcaagaagcagtacgcg
aatttcatcggcggtgaatgggtcaagccggttggcggcgagtacttcgacaacgtctcg
ccgattacgggcgaaccgttcacgtcgatcccgcgttcgcgcgaagccgacatcgaactt
gcgctggacgccgcgcatcgcgcgaaggcggcttggggcaagacgtcgaccaccgagcgc
gccaatatcctcaacaagatcgccgaccgcatggaggcgaacctgcagcgcctagccgtc
gccgagacgatcgacaacggcaagccgctgcgcgaaacgatggcggccgatattcccctc
gcaatcgatcacttccgctatttcgcgggcaccgtgcgcgcgcaggaaggcggcatttcg
gagatcgatcacgacacggtcgcgtatcactttcatgagccgctcggcgtggtcggtcag
atcattccgtggaacttcccgatcctgatggccacatggaagctcgcgcccgcgctcgca
gcaggcaattgcgtcgtgctgaagcccgcggaacagacgcccgcttcgatcctcgtgatg
ctcgaactgattcaggatctgctgccggcgggtgtgctgaacgtcgtcaatggtttcggt
ctcgaagcgggcaagccgctcgcgtcgaacaagcgcatcgcgaagatcgccttcacgggc
gaaacgacgacgggccgcctgatcatgcagtacgcgagccagaacatcattcctgtgacg
ctggaactcggcggcaagagcccgaacatcttcttcgccgacgtgctcgacaaggacgac
agcttcttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaatcagggcgaagtc
tgcacctgcccgtcgcgcgtgctgatcgaagagtcgatttacgaccgcttcatggagcgc
gcggtgaagcgcgtcgccgccatccagcagggacacccgctcgactcgaaaacgatgatc
ggcgcacaggcttcgcgggagcagctggaaaagatcctgtcatacatcgatctcggcaag
caggaaggcgcgcaatgcctgatcggcggtgagcagaacaagctcgacggcgaactcgcg
aagggctattacgtgaagccgaccgtgttccgcggtcacaacaagatgcgcatcttccag
gaagaaatcttcgggcccgtcgtttccgtcacgacgttcaagaacgaagaagaagcgctg
gagatcgccaatgacacgctgtatggcctcggcgccggcgtctggacgcgcgacggcacg
cgtgcctatcgcttcggccgcgagatccaggcaggccgcgtgtggacgaattgctaccac
gcgtacccggcgcatgcggcattcggcggctacaagcagtcgggcatcggacgcgaaaat
cacaagatgatgctcgatcactaccagcaaaccaagaatctgctggtcagctatagcgac
aaaccgttgggcttcttctga

DBGET integrated database retrieval system