KEGG   Paraburkholderia caribensis: K788_0003847Help
Entry
K788_0003847      CDS       T04141                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00010  Glycolysis / Gluconeogenesis
bcai00053  Ascorbate and aldarate metabolism
bcai00071  Fatty acid degradation
bcai00280  Valine, leucine and isoleucine degradation
bcai00310  Lysine degradation
bcai00330  Arginine and proline metabolism
bcai00340  Histidine metabolism
bcai00380  Tryptophan metabolism
bcai00410  beta-Alanine metabolism
bcai00561  Glycerolipid metabolism
bcai00620  Pyruvate metabolism
bcai00625  Chloroalkane and chloroalkene degradation
bcai00903  Limonene and pinene degradation
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K788_0003847
   00053 Ascorbate and aldarate metabolism
    K788_0003847
   00620 Pyruvate metabolism
    K788_0003847
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K788_0003847
   00561 Glycerolipid metabolism
    K788_0003847
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K788_0003847
   00310 Lysine degradation
    K788_0003847
   00330 Arginine and proline metabolism
    K788_0003847
   00340 Histidine metabolism
    K788_0003847
   00380 Tryptophan metabolism
    K788_0003847
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    K788_0003847
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    K788_0003847
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    K788_0003847
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     K788_0003847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALL65454
UniProt: A0A0P0RAM7
LinkDB All DBs
Position
1:complement(2816472..2817908)
Genome map
AA seq 478 aa AA seqDB search
MKTFEHFYIAGKWIKPCGTGMIDVIDSGTEEVMGRIPEGVEADAEAAIAAARAAFDGWAA
TPPKERGAYLQKIADNLKARTDELAGYICGEVGMPIKLARAIQVGGPVYNWRAYAKLAGE
FQFEEQVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAAALAAGCTIVLKPSEVAPLNAF
VLAEAIHEAGLPAGVFNLVSGYGPVVGEVLASHPSVDMVSFTGSTRAGKRVSELAAASVK
RVALELGGKSASVILDDADFAAAIKGTVGACFLNSGQTCSAHTRMIVPESRYDEARDLAK
KAAEAFVAGDPRVETTRLGPLASAAQQSRVQHYIARGIEEGAELVTGGAGMPDGISKGFF
VKPTVFGRVHPKATIAQEEIFGPVLTILTYKDEDEAVRIANDSVYGLGGAVWAGSDEHAM
SVARRIRTGQVDINGGAWNMAAPFGGYKQSGHGRENGTYGLEEYLEYKSMQLKVNKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcgagcacttctacatcgccggcaaatggatcaagccgtgcggcacaggc
atgatcgacgtgatcgactcgggcacggaagaagtgatgggccgcattcccgagggtgtc
gaagccgatgccgaggcggccattgccgctgcccgtgctgctttcgacggttgggcggcg
acgccaccgaaggagcgcggcgcgtacctgcaaaaaattgcagacaatctcaaggcgcga
accgatgaactcgcgggctacatctgcggtgaagtcggcatgccgatcaagcttgcgcgc
gcaatacaggtcggcggtcccgtgtataactggagggcctatgcgaagctcgcgggtgaa
ttccagttcgaagagcaggtcggcaattcgctcgtcgtgcgcgagcccgtcggcgtcgtt
gccgcgattacgccgtggaactatccgctgaaccaggtcacgctgaaggtggcagccgcg
cttgcggctggctgcactatcgtgctcaaaccgtcggaagtggcgccgctgaatgccttc
gtgttggcggaagcgattcatgaagccgggctgcccgccggcgtgttcaatctggtgagc
ggctatggtcccgtggtgggtgaagtgctcgcgagtcacccatccgtcgatatggtgtcg
ttcaccggctcgacgcgcgctggcaagcgcgtgtcggaactggcggccgcgtcggtgaag
cgcgtcgcactggaactaggcggcaaatcggcgtcggtcattctcgacgacgcggatttc
gctgcggcgatcaagggcacggtgggcgcgtgcttcctgaattcgggccaaacgtgctcg
gcgcacacgcgcatgatcgtgcccgaatcgcgctatgacgaagcgcgcgacctggcgaaa
aaggcagccgaagcatttgtcgcaggcgatccccgcgtcgagacgacacgtctgggtccg
ctggcttccgctgcgcagcagtctcgcgtgcagcactatattgcgcgtggcatcgaagaa
ggcgccgaactcgtcacgggtggtgccggcatgccggatggcatctcgaagggctttttc
gtgaaaccgactgtgttcggccgcgtgcatccgaaggcgacgattgcacaggaagaaatc
ttcggtccggtgctgaccatcctgacctacaaggacgaagacgaagccgtgcgcattgct
aacgactcggtgtacggactcggcggtgcggtatgggcggggagcgatgagcacgcgatg
agcgtcgcgcggcgcatccgcaccggacaggtcgatatcaacggcggcgcatggaacatg
gccgcaccgttcggcggctacaagcagtcgggacacgggcgtgagaacggcacctacggg
ctcgaagaatatctcgagtacaagtcgatgcaattgaaggtgaacaagcctgcatag

DBGET integrated database retrieval system