KEGG   Paraburkholderia caribensis: K788_0004737Help
Entry
K788_0004737      CDS       T04141                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00500  Starch and sucrose metabolism
bcai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    K788_0004737
Enzymes [BR:bcai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     K788_0004737
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     K788_0004737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ALL69044
UniProt: A0A0P0RJR9
LinkDB All DBs
Position
2:complement(3003046..3004710)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIIYCLSVGTFMDANGDGVGDFQGLMRRLDYLQGLGMTAIWLMPIQPSPGR
DNGYDISDYYNVDPRYGTLGDFAEFTHACAERGLRVIIDLVVNHTSDQHPWFKEARSDPD
SKYRDWYVWSDKKPPDAQRGVVFPGVQKSTWSLDKSAKRWYFHRFYDFQPDLNTSNPHVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPKVHQPVEQYEMLRTFREFLQWREGDAII
LAEANVLPDTDLKYFGDAGERLPMMFNFQVNQNTFYTLATGDTKPLKHALLATRPRPPSA
QWGVFLRNHDELDLGRLTPEQRAAVFSAFGPEPNMQLYERGIRRRLAPMLAGDRRRLELA
YSLMLSLPGTPVFRYGDEIGMGDDLRRAERACARTPMQWSTEPQGGFTKHPKPHTRVISG
GVYGFERVNVARQRRDPNSLLNWMERMIRMRKEVPEISWGDFDVLRTSRNDVLALCYHWR
NNSVLFLHSFGAEPCTVKFRSGCNEPVGCRLINLLSDDHSEPGADGRHAVVLEPYGYRWY
RVGGLDYLLKRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgacctctggtacaagaacgccatcatctactgtctatcggtagggaccttc
atggacgccaatggcgacggcgtaggtgatttccagggactcatgcgtcggctcgactac
cttcaaggtctcggcatgacggcgatctggttgatgcccattcaaccttcgcccggacgt
gacaacggttacgacatttccgactactacaacgtcgatccgaggtacggcacgctcggc
gacttcgccgaatttacccacgcctgtgccgagcgcggcttgcgggtgatcatcgacctc
gtggtcaaccacacttcggaccagcacccgtggttcaaggaagcacgcagcgatcctgat
tcgaaatatcgcgactggtatgtgtggtcagataaaaagccgccagacgcacaacgtggt
gtggtatttccaggcgtgcagaaatcgacatggagtttagacaaatctgcaaagcgctgg
tacttccatcgcttctacgattttcagccagatctgaatacctccaaccctcatgttcag
gctgagttgctgaaaatcatgggcttctggatacagctcggcgtatccggattccgcatg
gatgcagtgccattcgtgattgcaaccaaagggccgaaggtgcaccagcccgtcgagcaa
tatgaaatgctgcggacgtttcgagaattcctgcaatggcgtgaaggtgacgcgatcatt
ctggcggaagcgaatgtactcccggatacagacctgaagtatttcggtgatgcaggcgag
cgcttgcccatgatgttcaacttccaggtgaaccagaataccttctataccctcgcaacg
ggtgacacgaaaccgttgaagcatgcgctgctcgcgaccaggccacgccccccgagcgca
caatggggcgtgttcctgcgcaatcacgacgaactcgatctgggtcgcctcacgcccgaa
caacgcgctgccgtgttctctgcgttcggccctgagccgaacatgcaactctatgagcgc
gggatccgacgcagacttgccccgatgctggcgggcgacaggcgccgccttgaactcgcc
tacagtctgatgctcagtttgccgggcacgcccgtgttccgttacggcgatgagatcggg
atgggcgacgatctgcgccgcgccgagcgggcgtgtgcgcgcactccgatgcaatggtcg
acagagccacagggcggcttcaccaaacatccgaagcctcacacacgtgtcatatccggc
ggggtatatggtttcgagcgggtcaacgtggcccggcagcggcgcgacccgaactcgctt
ctcaactggatggagcggatgatccgcatgcgcaaggaagtccccgaaatcagttggggc
gatttcgacgtgctgcgcacgtcgagaaatgatgtcctcgcgctctgttatcactggcgc
aacaactcggtgctgtttctacatagcttcggcgctgagccatgcacggtgaagtttcgc
tcgggctgcaatgaaccggttggctgccgtctgatcaatctgctttcggacgaccatagc
gagcctggcgctgacggtcgtcatgcagtagtgctcgaaccttatggctatcggtggtat
cgggttggcggcctcgattatcttctgaagcgttcggaaatatag

DBGET integrated database retrieval system