KEGG   Paraburkholderia caribensis: K788_0005180Help
Entry
K788_0005180      CDS       T04141                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00061  Fatty acid biosynthesis
bcai00780  Biotin metabolism
bcai01100  Metabolic pathways
bcai01130  Biosynthesis of antibiotics
bcai01212  Fatty acid metabolism
Module
bcai_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    K788_0005180
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    K788_0005180
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    K788_0005180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcai01004]
    K788_0005180
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     K788_0005180
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     K788_0005180
Lipid biosynthesis proteins [BR:bcai01004]
 Fatty acid synthase
  Component type
   K788_0005180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALL67277
UniProt: A0A0N7JUT1
LinkDB All DBs
Position
2:1136940..1137719
Genome map
AA seq 259 aa AA seqDB search
MDTPKNQVMAQHKVLVVGIANEHSIAYGCARAFRELGAELAITYLNEKAKAYVEPLAQEL
GASLLLPLDVSKPGELEAVFEAIRATWGRLDVAVHSIAFAPKADLQGGLLNSSAEGFSVA
MDISCHSFIRMARLAAPLMDEGGSLFAMSYLGATRVVPNYDLMGPVKAALEASCRYLAHE
LGPKRIRVHPISPGPLKTRAASGLKDFDLLLNEAAERAPIGELVDIMDVGYTCAFLATPY
ARRMTGNTVFVDGGVSIIG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccaaagaaccaggtgatggcgcaacacaaggtgctggtggtcggcatcgcg
aacgagcattcgatcgcgtacggctgcgcgcgcgcgttccgtgagcttggcgccgaactc
gcgatcacctatctgaatgaaaaggcgaaggcttatgtcgagccgctcgcgcaggaactc
ggcgcgtcgctgctgctgccgctcgacgtatcgaagcccggcgaactcgaagcggtgttc
gaggcaatccgcgcgacgtggggacggctcgacgtcgccgtgcattcgatcgcgttcgcg
ccgaaggccgatctgcagggcggcctgctgaacagttcggcggaaggcttttcggtggcg
atggacatttcgtgccactcgttcatccgcatggcgcgcctcgccgcaccgctgatggac
gaaggcggatcgctgttcgccatgagctatctgggcgcgacgcgcgtcgtgccgaactac
gatctgatggggcccgtgaaggccgcgctcgaagcatcatgccgctatctcgcgcatgaa
ctcgggccgaaacgcatccgcgtgcatcccatttcgccgggaccgctgaagacgcgcgcc
gcgtcgggactcaaggacttcgatctgctgctcaacgaagccgccgagcgcgcgcccatc
ggcgaactcgtcgacatcatggacgtcggctatacctgcgcgttccttgcgacgccctac
gcgcgccgcatgacgggcaatacggtattcgtcgacggcggcgtgagcatcatcggctga

DBGET integrated database retrieval system