KEGG   Paraburkholderia caribensis: K788_0005213Help
Entry
K788_0005213      CDS       T04141                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
bcai  Paraburkholderia caribensis
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcai03400]
    K788_0005213
Enzymes [BR:bcai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     K788_0005213
DNA repair and recombination proteins [BR:bcai03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    K788_0005213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 DNA_pol_B_exo2 P63C
Motif
Other DBs
NCBI-ProteinID: ALL67244
UniProt: A0A0P0RFC7
LinkDB All DBs
Position
2:1107287..1109674
Genome map
AA seq 795 aa AA seqDB search
MSELQQGFLLTRHWRDTAAGTEVEFWLATDGGPRHIRLRPQPNVAFIPAAHGERAQDMLH
REKNAQSRGVELRPLDLCDFQHRPVLGLYCPQYRQLTALDKRLKQGGVDVYEADLFPPER
YMMERFITAPVLFGGEANPDGHGPLLNADMKPASGYRPKLKLVSLDIETSAHAELYSIAL
EGCGQRQVYMLGPQNGDAADIDFALEYCDTRAQLIERLIGWLEAHDPDAIIGWNVVQFDL
KVLHETAQQCGVPLRIGRGGAVMEWREHGLKQNHFFAGAAGRLIIDGIEALRSATWSFPS
FSLEYVAQAVLGEGKSIDNPYQRMDEIQRRFDEDKPALARYNLKDCELVTRIFGKTDLLP
FLLERATVTGLPADRSGGSVAAFTHLYMPRMHRLGYVAPNLGDVAGAASPGGFVMDSKPG
LYDSVLVLDYKSLYPSIIRTFLIDPVGLVDGVRHPDDGHSVPGFLGARFSRAHHCLPSIV
AQVWEGREAAKREQNKPLSQALKIIMNAFYGVLGSTGCRFFDPRLASSITMRGHEIMHRT
RELIEARGYAVIYGDTDSTFVWLRHAHDEEDAARIGRELVSGINAWWREHLRERFGLESA
LELQFERHYKRFFMPTVRGAEEGSKKRYAGLTVLADGSEDVVYKGLETVRTDWTPLAQRF
QQELYLRIFKQQPYRDYVRDYVRRTLAGEFDDLLVYRKRLRRPLSDYERNVPPHVRAARS
ADEFNRQRGRPLQYQNGGWISYVMTGSGPEPLETLRSDIDYGHYLTRQLQPVADAILPLL
KDDFVTLASGQKQLF
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgagcttcaacaagggtttcttctcacccgtcattggcgcgatacggctgccgga
acggaggtcgagttctggctcgcgaccgacggcggtccgcgccatatccgcctgcgcccg
cagccgaacgtcgcgttcatccccgccgcgcacggcgagcgcgcgcaagacatgctgcac
cgggagaaaaacgcccagtcgcgcggcgtcgaactgcgcccgctcgatttgtgcgacttt
cagcatcggccggtgctgggactgtattgcccgcagtaccggcagctgaccgcgctcgac
aagcggctgaagcaaggcggcgtcgacgtctacgaagccgatctcttcccgcccgagcgc
tacatgatggagcgcttcatcaccgcgcccgtgctgttcggcggcgaagcgaatcctgac
ggtcatggcccgttgcttaacgccgacatgaagcccgcgagcggctaccgtccgaagctc
aagctggtgtcgctcgatatcgaaaccagcgcccacgccgagttgtattcgatcgcactg
gaaggctgcgggcagcgtcaggtgtacatgctcggaccgcaaaacggcgacgcggcggac
atcgacttcgcgctcgagtattgcgacacgcgggcgcaactgatcgagcggctgatcggc
tggctggaggcgcacgatcccgatgcgatcatcggctggaatgtcgtgcagttcgacctg
aaagtgctgcatgagaccgcgcagcagtgcggcgtgccgctgcgcatcgggcgcggcggc
gcggtgatggaatggcgcgagcatggcctgaagcagaaccatttcttcgcgggcgcggcg
gggcggctgatcatcgacggcatcgaggcgctgcgctcggccacgtggagctttccgtcg
ttcagcctcgaatacgtcgcgcaggcggtgctgggcgaaggcaagtcgatcgacaacccg
tatcagcggatggacgagatccagcgccgcttcgacgaggacaagcctgcgctcgcccgc
tacaacctgaaagactgcgagctcgtcacgcgcatcttcggcaagacggacctgctgccg
ttcctgctcgaacgcgcgaccgtcaccgggctgcctgccgaccgcagcggcggatcggtg
gcggcgttcacgcatctatatatgccgcgcatgcaccggctcggctacgtcgcgccgaat
ctgggcgacgtagcgggcgcggccagtcctggcggcttcgtgatggactcgaagcccggt
ctctatgattccgtgctggtgctcgactacaagagcctgtacccgtcgatcatccgcacg
tttctgatcgaccccgtgggactggtcgatggcgtgcgtcatcccgacgacgggcattcc
gtgcccggtttccttggcgcgcgtttttcgcgcgcgcaccattgcctgccgtcgatcgtc
gcgcaggtgtgggaggggcgcgaagccgcgaagcgcgagcagaacaagccgttatcgcag
gcgctgaagatcatcatgaacgcgttctatggcgtgcttggctcgacgggctgccggttc
ttcgatccgcgcctggcgtcgtcgatcacgatgcgcggccacgagatcatgcaccgcacg
cgtgagttgatcgaagcgcgcggctatgcggtgatctacggcgacaccgattcgacgttt
gtgtggctgcgccacgcgcatgacgaggaagacgcggcgcgcatcggacgagagctggtg
agcggaatcaatgcctggtggcgtgagcatttgcgcgagcgcttcgggctggagagcgcg
ctggaattgcaattcgagcggcattacaagcgctttttcatgccgaccgtgcgcggcgcg
gaggaaggcagcaagaagcgttatgcggggttgactgtgcttgccgacggcagtgaagac
gtcgtctacaaagggctcgaaacggtgcgcaccgattggacaccgctcgcgcaacgcttt
cagcaggaactgtatctgcggattttcaagcagcagccgtatcgggattatgtgcgtgat
tatgtgcggcgcacgctggcgggtgagttcgatgatctgctcgtgtatcgcaagcggctg
cgccggccgctgtccgactatgagcgcaatgtgccgccgcatgtgcgtgctgcgcgttcc
gccgatgagttcaaccggcagcgcggtcggccgctgcaatatcagaatggtggatggatc
agttatgtgatgaccggcagcgggcctgagcctcttgaaacgctgcgttcggatattgac
tatgggcattatctgacgcggcagcttcagcctgtggcggatgcgattttgcctttgctg
aaggatgattttgttaccttggcgtcgggacagaagcagttgttctga

DBGET integrated database retrieval system