KEGG   Paraburkholderia caribensis: K788_0005216Help
Entry
K788_0005216      CDS       T04141                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcai  Paraburkholderia caribensis
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    K788_0005216
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     K788_0005216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 K_oxygenase HI0933_like Glutaredoxin DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: ALL67241
UniProt: A0A0P0RF35
LinkDB All DBs
Position
2:complement(1104707..1106299)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVSRPIEIVASVDDSAKSQEMLALLNDIATLSERVSVIERRGDDE
RKPSFSIGEPGKAAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDAVIQQIRELDSDYA
FETYFSLSCQNCPEVVQALNIMALINPRIQHVAIDGALFQNEVESRQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDVLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRAEALIPGKINE
VRLASGAVLKAKTIVLATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGVVSYVTLIEFGAQLRADEVLQRKLRSLANVTVITQAQTTEITGDGKKV
NGLTYTDRASGESKHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRTSVEDLEDAQAAELAEA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcgaatctgaagacccaactcaaagcctacctcgagaaagtcagccgtccc
atcgagatcgtcgcttccgtcgacgacagcgcgaagtcgcaggaaatgctcgcgctgctc
aacgacatcgcgacgctgtcggagcgggtcagcgtgatcgagcgccgcggtgacgacgag
cgcaagccgtcgttttcgatcggcgagccgggcaaggctgcgggcatccgcttcgcaggc
attccgatgggtcatgagttcacgtcgctggtgctggcgctgctgcaaacgggcggccac
ccgatcaagctcgacgacgcggtgatccagcagatccgcgaactcgacagcgactacgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
atcatggcgctgatcaacccgcgcatccagcacgtggcgatcgacggcgcgctgttccag
aacgaagtcgagtcgcgtcagatcatggccgtgccgaccatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacaccaacgccggc
gcgcgtgccgcgaaggaactggagaagaagccggtgttcgatgtgctgatcgtcggcggc
ggtcctgctggcgcggcggctgcgatctactcggcgcgcaaggggattgcgacgggtgtc
gtggcggaacgcttcggcggccaggtgctcgacacgctcgcaatcgaaaacttcgtctcc
gtgcaggaaacggaagggccgaagttcgccaccgcgctcgagcagcacgtgaagagctac
gaagtcgatgtgatggacgtgcagcgcgccgaagcgctgattcccggcaagatcaacgaa
gtgcgcctcgcgagcggcgcggtgctgaaggcgaagacgatcgtgctggcgacgggcgcg
cgctggcgcgagatcaacgtgccgggcgagcgcgagtaccgcaaccatggcgtggcgtac
tgcccgcactgcgatggtccgctattcaagggcaagcgcgtggcggtggtcggcggcggc
aactcgggcgtcgaagcggcgatcgacctggcgggtgtcgtgagctacgtgacgctgatc
gaattcggcgcacaactgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctcgct
aacgtgacggtcatcacccaggcgcagacgacggaaatcacgggcgacggcaagaaggtc
aacggtctgacctacacggaccgcgcgtcgggcgagtcgaagcatgtcgagctcgaaggc
gtgttcgtgcagatcggcctggtgccgaacaccgaatggctgaagggcacggtcgagctg
tcgaagcacggcgagatcgtcgtcgatgcgaagggcgcgacgtcggtaccgggcgtgttc
gccgctggcgacgtaaccacggtgccgttcaagcagatcgtgatcgccgtgggcgagggc
gcgaaggcatcgctggccgcgttcgatcatctgatccgcaccagcgtcgaagatctggaa
gacgcgcaggcagcggaactggccgaggcctga

DBGET integrated database retrieval system