KEGG   Paraburkholderia caribensis: K788_0005896Help
Entry
K788_0005896      CDS       T04141                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00020  Citrate cycle (TCA cycle)
bcai00480  Glutathione metabolism
bcai01100  Metabolic pathways
bcai01110  Biosynthesis of secondary metabolites
bcai01120  Microbial metabolism in diverse environments
bcai01130  Biosynthesis of antibiotics
bcai01200  Carbon metabolism
bcai01210  2-Oxocarboxylic acid metabolism
bcai01230  Biosynthesis of amino acids
Module
bcai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcai_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    K788_0005896
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    K788_0005896
Enzymes [BR:bcai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     K788_0005896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALL62838
UniProt: A0A0P0R4C1
LinkDB All DBs
Position
1:complement(97572..98828)
Genome map
AA seq 418 aa AA seqDB search
MAYQHITVPADGDKITVNADFSLNVSDQPIIPYIEGDGTGVDITPVMIKVVDAAVAKAYG
GKKKIHWMEIFAGEKATKVYGPDVWLPEETLQVVKDYIVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPLREPEKVNMVIFRENSEDIYAGIEWPAGSPEAKKVIQF
LREEMGVKKIRFPDSSGIGVKPVSREGTERLVRKAIQYALDHDRRTVTLVHKGNIMKYTE
GAFRDYGYALAQKEFGAELIDGGPWMKVKNPKTGNDVVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADAILKSMEKSILSKRVTYDFARLMEGATQVSCSGFGQVMIDNM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcagcacatcacggttccggctgacggtgacaagatcaccgtcaacgcggat
ttctcgctcaacgtttccgatcagccgattattccgtacatcgaaggtgacggaacgggc
gtcgacattacgcccgtgatgatcaaggtcgtcgatgcagccgtcgccaaggcctacggc
ggcaagaagaaaatccactggatggaaatcttcgcgggcgagaaggcgaccaaagtgtat
ggtcccgacgtatggctgccggaagaaacgctgcaggtggtgaaggactacatcgtgtcg
atcaaaggtccgctcacgacgcccgtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggaactggacctctacgtgtgcctgcgtcccgtgcagtacttcaaaggcgtgccg
tcgccgctgcgcgagccggagaaggtcaacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatggccggcgggctcgcccgaggcgaagaaggtcatccagttc
ctgcgcgaggaaatgggcgtgaagaagatccgctttccggactcgtcgggtatcggcgtg
aagccggtgtcgcgcgagggcaccgagcgtctggtgcgcaaggcgatccagtatgcgctc
gaccacgatcgccgcacggtcacgctggtgcacaagggcaacatcatgaagtacacggaa
ggcgcattccgtgactacggctatgcgctcgcgcaaaaagagttcggtgcggagctgatc
gatggcggtccgtggatgaaggtgaagaatccgaagacgggcaacgacgtcgtcgtgaag
gacgtgatcgccgatgcgttccttcagcagatcctgctgcgtcccgccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcggcattgcgccgggcgcgaacatgtcggactcggtcgcgatgttcgaagccacg
cacggcacggcgccgaagtacgcgggcaaggactatgtgaatccgggctcggagattctg
tcggcggagatgatgctgcgccatctgggctggacggaggcggcggatgcgattctgaag
tcgatggaaaagtcgattctgtcgaagcgcgtgacgtatgacttcgcgcgcctgatggaa
ggtgcgacccaggtgtcgtgctcgggcttcggtcaggtgatgatcgacaacatgtga

DBGET integrated database retrieval system