KEGG   Paraburkholderia caribensis: K788_0007391Help
Entry
K788_0007391      CDS       T04141                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00630  Glyoxylate and dicarboxylate metabolism
bcai01100  Metabolic pathways
bcai01120  Microbial metabolism in diverse environments
bcai01200  Carbon metabolism
Module
bcai_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bcai00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K788_0007391
Enzymes [BR:bcai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     K788_0007391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALL69862
UniProt: A0A0P0RLT9
LinkDB All DBs
Position
unnamed:509172..510677
Genome map
AA seq 501 aa AA seqDB search
MNDFSKEAVKPAGSESTPESTPQRSRYSAGVLKYREMGYWQPDYTPKDTDIIALFRITPQ
PGVEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAFRVDLVPNASESEPQYFAFIA
YDLDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERL
DKYGRPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMHWRDRYLFAM
EAVARAQAETGELKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAITSMGRW
ARKNDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLDGDPLSVQ
GYYNVLRESHNPVDLTRGLHFEQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFG
GGTIGHPSGIQAGATANRVALETMVKARNEGRDIASEGPDLLEAAARHCTPLKQALDTWG
DITFNYTPTDTPDFAVTPSVA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagcaaggaagccgtgaagcccgcaggcagcgaaagcacaccagaaagc
acaccacaacgctcgcgctattcggcgggtgtcctcaagtatcgcgagatgggctactgg
cagccggactacacgccaaaagacaccgacatcatcgcgctgttccgcatcacgccgcag
ccgggcgtcgagcccgaagaagccgccgccgccgtcgcgggcgaatcgtcgacggccacc
tggaccgtggtctggaccgaccgcctgaccgcgtgcgacatgtatcgcgccaaagcgttt
cgcgtcgatctcgtccccaacgccagcgaaagcgaaccgcagtacttcgcgttcatcgcc
tatgacctcgatctgttcgaggaaggatcggtcgcgaacctcactgcctcgatcatcggc
aatgtgttcggcttcaagccgctgaaagcgctgcggctcgaagacatgcgcattcccgtc
gcgtatctgaagacctttcagggtccgccgacaggcatcgtcgtggaacgcgaacggctc
gacaaatacggccgcccgctgctcggcgcgaccgtcaagcccaagctcgggctgtcgggc
aagaactatggacgcgtcgtgtacgaaggcctcaagggcggcctcgattttctgaaggat
gacgaaaacatcaattcgcagcccttcatgcattggcgcgaccgttatctgttcgcgatg
gaggcggtagcccgcgcgcaagccgagacgggcgaactgaagggccattacctgaacgtg
acggcgggcacgatggaggacatgtacgaacgcgcagaattcgcaaaggaactcggctcg
tgcatcgtgatgatcgatctggtgatcggctggacggcgatcacgtcgatgggacgctgg
gcgcgcaagaacgacatgatcctgcatctgcatcgcgccggacatggcacgtacacgcgg
cagcgcaatcacggcatttcgtttcgcgtgatcgcgaagtggctgcgcatggcgggcgtc
gatcatgcgcatgcgggcacggccgtcggcaagctcgatggcgatccgctctcggtgcag
ggctattacaacgtgctgcgcgagtcccacaaccccgtcgatctcacgcgcggcctccat
ttcgagcagccgtgggcaggcttgcgcaaggtgatgcccgtcgcgtcgggcggcattcac
gcggggcagatgcatcagttgctcgatctgttcggcgatgacgcgatcctgcagttcggc
ggcggcacgatcggccatccgtccgggattcaggcgggtgcgacggcgaaccgcgtcgcg
ctcgaaacgatggtcaaggcgcgcaacgaaggccgcgacatcgccagcgaaggccccgat
ctgctcgaagcggcagcgcgtcattgcacgccgctcaagcaggcgctcgatacatggggc
gacatcacgttcaactacacgccgaccgatacacccgacttcgccgtcacgccgagcgtg
gcctga

DBGET integrated database retrieval system