KEGG   Paraburkholderia caribensis: K788_0007760Help
Entry
K788_0007760      CDS       T04141                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00550  Peptidoglycan biosynthesis
bcai01100  Metabolic pathways
bcai01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bcai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K788_0007760
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    K788_0007760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bcai01003]
    K788_0007760
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcai01011]
    K788_0007760
Enzymes [BR:bcai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     K788_0007760
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     K788_0007760
Glycosyltransferases [BR:bcai01003]
 Polysaccharide
  Bacterial polysaccharide
   K788_0007760
Peptidoglycan biosynthesis and degradation proteins [BR:bcai01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   K788_0007760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ALL63829
UniProt: A0A0N7JTK0
LinkDB All DBs
Position
1:complement(1122932..1125325)
Genome map
AA seq 797 aa AA seqDB search
MQSTTPTSPPSPPQKRKRPLWLKIILGFVGLIFAGILCVLLVLGYALVVATPNLPSLDAL
TDYRPKVPLRIYTADHVLIGEFGEERRDIVHMREVPDNLKKAVLAIEDARFYDHGGVDLM
GIARAGVVALTNGHATQGASTITMQVARNFFLSSEKTYTRKIYEMLLAYKIESKLSKDQI
LEVYMNQIYLGQRAYGFASAARVYFGKDLKDLSLAECAMLAGLPKAPSAYNPVVNPKRAK
VRQEYILQRMLELGYITQDQYDTASRQPLIVKGAGKEFSVHAEYVAEMVRQMMYAQYREE
AYTRGLNVVTTIDSADQDAAYRALRKGLMDYERRHGYRGPEAFIDLPADADEREQAIDDA
LLEHPDNGEIIAAVVTSASPKQVQATLIDGNAVTIQGDGLRYATFALSTRAQPNQRVRPG
AIIRIVKNDDGNWSITQLPQIEGAFVSVVPQDGAIRALVGGFDFNKNKFNHVTQAWRQPG
SSFKPFIYSASLEKGLGPATVINDAPLFFSAAETGGQAWEPKNYGGGFDGPMSMRTALQK
SKNLVSIRILNHIGTKYAQQYITRFGFDAERHPAYLPMALGAGLVTPLQMAAGYSVFANG
GFRVNPYLIAEVTDQRGMAVAHADALVAGSNAPHAIEARNAYVMNSLLTSVAQRGTGAKS
NVLKRTDLAGKTGTTNDSRDAWFAGYQHTLCAIAWMGYDSPRSLGDKETGGGLALPVWID
YMGRALKGVPEYKMPMPEDVVSIGDELYFDDFTPGNGFVSTVGVTLPPPGASDAASAAPA
AVGAQEKEDIMNLFKGH
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccacgactcctacgtctccgccttcaccaccgcagaagcgcaagcgtccgctg
tggctgaagatcatccttggcttcgtcgggctgatcttcgccggaatcctctgcgttttg
ctcgtgctgggttacgcgctggtcgtcgccacgcccaatctgccttcgctcgacgcgttg
accgactatcgcccgaaggtgccgctgcgcatctacacggcagatcacgtgctgatcggc
gaattcggcgaagagcgccgcgacatcgtgcacatgcgcgaggtgccggataacctcaag
aaggccgtgctcgccatcgaagacgcgcgcttttacgatcacggcggcgtcgatctgatg
ggtatcgcacgcgccggcgtggtcgcgctcacgaacggccacgcaacgcaaggcgcgagc
acgatcacgatgcaggttgcgcgcaacttcttcctgtccagcgagaagacgtacacgcgc
aagatctacgagatgctgctcgcgtacaagatcgaatcgaagctgagcaaagatcagatt
ctcgaggtgtacatgaatcagatctatctcggccagcgtgcgtacggcttcgcgagcgcg
gcgcgggtgtacttcggcaaggacctgaaagacctgtcgctggccgaatgcgcgatgctc
gccggtctgcccaaagcgccctccgcgtataacccggtggtgaatccgaagcgcgcgaaa
gtgcgtcaggaatacatccttcagcgcatgctggaactcggctatatcacgcaggaccag
tacgacacggcgagccgtcagccgctcatcgtcaagggcgctggcaaggagttcagcgtg
cacgcggagtacgtcgcggaaatggtgcggcagatgatgtacgcgcagtaccgcgaagag
gcgtacacgcgcggcctgaacgttgtgacgaccatcgattccgccgatcaggacgccgcc
taccgggcgttgcgcaagggcttgatggactatgaacggcgtcacggctatcgcggtccg
gaagcgttcatcgacctccccgccgacgcggacgaacgcgagcaggccatcgacgacgcg
ctgctcgagcatcccgacaacggcgaaatcatcgcggccgtcgtgacgtcggcgagtccg
aagcaggttcaggcgacgctgatcgacggcaacgccgtgacgatccagggcgacgggctg
cgctacgcgacattcgcgctgagcacgcgcgcgcagccgaaccagcgcgtgcggccgggc
gcgatcatccgtatcgtgaagaacgacgacggcaactggtcgatcacgcaattgccgcag
atcgaaggcgcattcgtatccgtcgtgccgcaggatggcgcgatccgcgcgctcgtcggc
ggcttcgacttcaacaagaacaagttcaatcacgtgacgcaggcgtggcgtcagccgggt
tcgagcttcaagccgttcatctattcggcgtcgctagaaaagggtttgggaccggcaacc
gtcatcaacgacgcgccgctctttttcagcgcagctgaaacaggcggccaggcgtgggag
ccgaagaactacggcggcggcttcgacggcccgatgtcgatgcgcaccgcgctgcagaag
tcgaagaacctcgtgtcgatccgcatcctcaaccacatcggcacgaagtacgcgcagcag
tacatcacgcgcttcggtttcgatgctgaacgtcaccccgcctatctgccgatggcactg
ggcgcaggcctcgtcacgccgctgcagatggcggctggctactcggtgttcgccaacggc
ggctttcgcgtgaatccgtatctgatcgccgaagtcaccgatcagcgcggcatggccgtc
gcgcatgcggacgcgctcgtcgccggcagcaacgcgccgcacgcaatcgaagcgcgcaac
gcgtatgtgatgaacagcctgctgacgagcgtcgcgcagcgcggcacgggggcgaagtct
aacgttctgaagcgcacggacctcgcaggcaagacgggcaccaccaacgattctcgcgac
gcgtggttcgccggctatcagcacacgctttgtgcgattgcgtggatgggctacgacagc
ccgcgcagtctcggcgacaaggaaacgggcggcgggctcgcactgcccgtgtggatcgac
tatatgggacgcgcgctcaagggcgtgcccgagtacaagatgccgatgccggaagacgtc
gtgtcgatcggcgacgagctgtacttcgacgacttcacgccgggcaacggcttcgtgtcg
acggtcggggtgacgctgccgccgccgggagccagcgatgcagcaagcgcggcgccggcc
gcggtcggcgcgcaggagaaagaggacatcatgaacctgttcaaaggccactga

DBGET integrated database retrieval system