KEGG   Paraburkholderia caribensis: K788_0008096Help
Entry
K788_0008096      CDS       T04141                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00620  Pyruvate metabolism
bcai00680  Methane metabolism
bcai01100  Metabolic pathways
bcai01120  Microbial metabolism in diverse environments
bcai01200  Carbon metabolism
Module
bcai_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    K788_0008096
  Energy metabolism
   00680 Methane metabolism
    K788_0008096
Enzymes [BR:bcai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     K788_0008096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALL64462
UniProt: A0A0P0R8R6
LinkDB All DBs
Position
1:complement(1787119..1790214)
Genome map
AA seq 1031 aa AA seqDB search
MTSSGSARPARRTTASPDAVNTASAAPAASAVKAAKAAKATQALDSGKTGKSTKTKAPAN
GASKRIKPDGAGKQEAARASKETKNGAAPQLKDNARTREDKDQPLFEDIRYLGRLLGDVV
REQEGDAVFDVVEAIRQTAVRFRREDDSVAAQALDKKLRALSPEQTVSVVRAFSYFSHLA
NIAEDRHRNRRHRIHDLAGSTSQPGTIAHALDRLVEANAAATPVLQQFFNDALIVPVLTA
HPTEVQRKSILDAQHDIARLLAERDQPLTARERLQNESLLRARVTSLWQTRMLRDSRLTV
ADEIENALSFYRATFLEEIPALYADIEEALVEHGLDARLPPFFQMGSWIGGDRDGNPNVT
GETLENAITRQAAVIFEHYLEQVHKLGAELSVSNLLAGASDGLKALAEASPDHSPHRTDE
PYRRALIGIYTRLGASARVRLGEGVVPLRSAGPGAPKIRATPYDDSSEFVGDLHVLIDSL
TEHHGASLATPRLSPLTRAAEVFGFHLASIDLRQSSDIHEAVIAELLRRAGVESDYAALS
EADKLRVLLAELAQPRLLRSPYVEYSDLVKSELGVLEQARVTREKFGARAVRNYIISHTE
TVSDLVEVMLLQKEAGLLQGALGNPVDPARAGLMVIPLFETIPDLRNASHIMRDLLALPG
IDAIIENQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNERGITLRLFHGRGG
TVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPDIGRRNLETVVAATLEASL
LPHGNAPSQLPDFEEVMQTLSDAAMASYRALVYETPGFTEYFFSSTPIAEIAELNIGSRP
ASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAGWLEGAGSNVERERRVS
LLRKMHKAWPFFANLLSNMDMVLAKTDLAVASRYAALVADKKLRKHVFERIVAEWERTSN
VLSEITGKKERLADNPLLARSIKNRFPYLDPLNHLQVELLKRHRAGDDNVRVRRGIHLTI
NGIAAGLRNTG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccctgcccgccgcactactgcctcgcccgatgccgtc
aacactgcatcggccgctcccgccgcttccgctgtcaaggccgcgaaggccgcgaaagct
acgcaagctctcgactccggcaaaaccggcaaatccacgaagaccaaggcgcccgcgaac
ggcgcctcgaaacggattaaacccgacggcgccggcaagcaggaagccgcgcgtgcgtcg
aaagaaaccaagaacggcgccgcgccgcagctgaaggacaacgcccgcacgcgcgaagac
aaggatcagccgctgttcgaagacatccgctatctgggacgcctgctcggcgacgtggtg
cgcgagcaggaaggcgacgccgtgttcgacgtcgtcgaagcgattcgtcagacggctgtg
cgctttcgccgcgaggacgacagcgtcgccgcccaggcgctcgacaagaagctgcgcgcg
ctgtcgcccgaacagacggtgagcgtggtgcgcgcgttcagctacttctcgcacctcgcg
aacatcgcggaagaccgtcatcgcaatcgccggcaccgcattcacgatctggccggctcg
acgtcgcagccgggcacgatcgcgcacgcgctcgaccggctcgtcgaagcgaacgccgcc
gcgacgcccgtgctgcagcagttcttcaacgacgcgctgatcgtccccgtgctgacggca
cacccgacggaagtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcggctg
ctggccgaacgcgaccagccgctgacggcgcgcgagcgtctgcaaaacgagtcgctgctg
cgcgcgcgcgtgacgtcgctgtggcagacgcgcatgctgcgcgactcgcgcctgacggtc
gccgatgaaatcgagaacgcgctgtcgttttatcgcgcgacgttcctcgaagagattccg
gcgctctacgccgacatcgaggaagcgctcgtcgagcacggcctcgacgcgcgcctgccg
cccttcttccagatgggcagctggattggcggcgaccgggacggcaatccgaacgtcaca
ggcgagacgctcgaaaacgcgatcacgcgccaggccgcggtgatcttcgagcactatctg
gaacaggtgcacaagctcggcgcggaactgtcggtgtcgaatctgctggcgggggcgagc
gacggactgaaggcgctcgcggaagcctcgcccgatcactcgccgcaccgcacggacgaa
ccgtaccggcgcgcgctgatcggcatttacacgcggctcggcgcgagtgcgcgcgtgcgg
ctcggcgaaggcgtcgtgccgctgcgcagcgccggccccggcgcgccgaagatccgcgcg
acgccttatgacgattcgtccgagttcgtgggcgatctgcacgtgctgatcgattcgctg
accgagcatcacggcgcgtcgctggcgacgcctcgtctgtcgccgctgacgcgcgccgcc
gaagtgttcggcttccacctcgcgagtatcgatctgcgccagagctccgacattcacgaa
gcggtgatcgcggagctgctgcggcgcgcgggtgtcgaaagcgactacgcggcgctgtcg
gaagccgacaagctgcgcgtgctgctcgcggaactcgcgcagccgcgcctgctgcgttcg
ccgtacgtcgagtactcggatctggtgaagagcgaactcggcgtgctggaacaggcgcgc
gtgacccgtgagaagttcggcgcgcgtgcggtgcgcaactacatcatttcgcacacggag
acggtgagcgatctggtcgaagtgatgctgctgcaaaaggaagcggggctgctgcaaggc
gcgctcggcaacccggtcgatccggcgcgcgcgggcctgatggtgatcccgctcttcgag
acgattcccgacttgcgcaacgcgtcgcacatcatgcgcgatctgctggcgctgccgggc
atcgatgccatcatcgagaatcagggcaacgagcaggaagtgatgctcggctattcggac
agcaacaaggacggcggcttcctgacgtcgaactgggagctgtaccgtgcggaactggcg
ctggtgtcgctgttcaacgagcgcggcatcacgctgcgcctgttccatggacgcggcggc
acggtgggacgcggcggcggcccgacttaccaggcgattctttcgcagccgccggggacg
gtcgatggacagatacgcctgacggaacagggcgaggtgatcgccagcaagttcggcaac
ccggacatcggccggcgcaatctggagacggtcgttgccgcgacgctcgaagcgtcgttg
ctgccgcacggcaatgcgccgtcgcaactgcccgacttcgaggaagtgatgcagacgctg
tcggatgcggcgatggcgtcgtaccgggcgctggtctatgagacgccgggcttcaccgaa
tacttcttctcgtcgacgccgattgcggagatcgcggagttgaacatcggcagccggccg
gcgtcgcgcaagctgcaggacccgaagcagcgcaaaatcgaggatttgcgggcgattccg
tggggcttctcatggggacaatgccggctgctgctgacgggctggtatgggtttggtagc
gcggttgctggatggctcgagggcgcgggctcgaatgtcgagcgtgagcgtcgtgtgagt
ctgctgcgcaagatgcataaggcgtggccgttctttgcgaatttgctgtcgaatatggat
atggtgctggccaagaccgatctcgcggtggcgtcgcgttatgccgcgcttgtcgctgac
aagaagctgcgtaagcatgtgttcgagcgcattgtggcggagtgggagcgcacgtccaat
gtgctttccgagattaccggcaagaaagaacgtcttgctgataatcctttgctcgcgcgg
tctatcaaaaaccggtttccgtatctcgatcctttgaatcacctgcaggtggaactgctt
aagcgacatcgcgcgggggatgataatgtccgcgtgcggcgtgggattcatctcactatc
aatgggattgcggcggggttgaggaataccggctga

DBGET integrated database retrieval system