KEGG   Paraburkholderia caribensis: K788_0008208Help
Entry
K788_0008208      CDS       T04141                                 

Definition
(GenBank) Glutathione S-transferase N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcai  Paraburkholderia caribensis
Pathway
bcai00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcai00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    K788_0008208
Enzymes [BR:bcai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     K788_0008208
Transporters [BR:bcai02000]
 Other Transporters
  Pores ion channels [TC:1]
   K788_0008208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALL64670
UniProt: A0A0P0R8Y1
LinkDB All DBs
Position
1:1988698..1989345
Genome map
AA seq 215 aa AA seqDB search
MIKLHGFALSNYYNKVKFALLEFGIPFEEVFVAASQDEAMLEHSPLGKVPYIVTEHGSLC
ESQAIIEYLAAAFPEKAIFSRDPWEAAKERELITFVDVHLELTARNLYKQAFFGGTITDA
TKGRTEKLLIHHIRGFRRLAKFTPYLRGEQFSIADVAGFVSLPLVGLATQAVYGRDFLLD
VGIDWKPYVKAINARPAAQRVTDDRKAYMEAQKKQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgcacggttttgcgctgtccaactattacaacaaagtgaagtttgcgctg
ctcgaattcggcattccgttcgaagaggtgttcgtggcggcgagccaggacgaggcgatg
ctcgagcactcgccgctcggcaaggtgccgtacatcgtgacagagcatggcagcctgtgc
gagtcgcaggcgatcatcgaatatctggccgcggcctttcccgagaaggcaatcttctcg
cgcgacccgtgggaagccgcaaaggagcgcgagctgatcacgttcgtcgacgtgcatctc
gaactgacggcgcgcaatctgtacaagcaggcgttcttcggcggcacgatcaccgacgcc
acgaaagggcgcaccgagaaactgctgatccatcatatccgcggcttcaggcggcttgcg
aagttcacgccgtatctgcgcggcgagcagttcagcatcgcggacgtggcgggcttcgtg
agcttgccgctcgtcggcctggcgacgcaggccgtgtacgggcgcgattttctgctcgat
gtcggcatcgactggaagccgtacgtgaaggcgatcaatgcacgcccggccgcgcagcgc
gtgacggacgaccgcaaggcctacatggaagcgcaaaagaagcaatga

DBGET integrated database retrieval system