KEGG   Brucella canis RM6/66: DK60_1887Help
Entry
DK60_1887         CDS       T03270                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00020  Citrate cycle (TCA cycle)
bcar00190  Oxidative phosphorylation
bcar00650  Butanoate metabolism
bcar01100  Metabolic pathways
bcar01110  Biosynthesis of secondary metabolites
bcar01120  Microbial metabolism in diverse environments
bcar01130  Biosynthesis of antibiotics
bcar01200  Carbon metabolism
Module
bcar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK60_1887
   00650 Butanoate metabolism
    DK60_1887
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DK60_1887
Enzymes [BR:bcar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DK60_1887
    1.3.5.4  fumarate reductase (quinol)
     DK60_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AIJ81658
LinkDB All DBs
Position
1:complement(1948402..1949181)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQMEWLQSHEDRRKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgacatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagatggaatggctgcaaagccatgaggac
cgccggaagctcgatggtctttatgagtgcattctgtgtgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgaccgttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgaacgccgcgtgtaa

DBGET integrated database retrieval system