KEGG   Brucella canis RM6/66: DK60_21Help
Entry
DK60_21           CDS       T03270                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00340  Histidine metabolism
bcar01100  Metabolic pathways
bcar01110  Biosynthesis of secondary metabolites
bcar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DK60_21 (hisE)
Enzymes [BR:bcar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     DK60_21 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AIJ82806
LinkDB All DBs
Position
1:15572..15895
Genome map
AA seq 107 aa AA seqDB search
MSQFTLADLERIVAERASVTDGTSYTASLVAKGQPKAAQKLGEEAVETVIAAVSGDRAGV
VSESADLLYHLAVVWNIAGVALEDVLQELQRRTAQTGLAEKASRPKG
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtttacgcttgcagaccttgaacggatcgtggccgagcgcgccagcgtgacg
gatggtacatcctatacggcaagccttgtggcgaaagggcagccgaaggctgcgcagaaa
ctgggcgaggaagcggtggaaacggtgatagcagccgtttccggcgaccgtgccggtgtc
gtctcggaaagtgccgatctgctctatcatctggcggtggtctggaatattgcaggcgtg
gcgctggaggatgtgcttcaggaacttcagcgccgcaccgcccagaccggccttgcggaa
aaggccagccgcccgaagggctga

DBGET integrated database retrieval system