KEGG   Brucella canis RM6/66: DK60_301Help
Entry
DK60_301          CDS       T03270                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00564  Glycerophospholipid metabolism
bcar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DK60_301
Enzymes [BR:bcar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DK60_301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ83162
LinkDB All DBs
Position
1:324986..326497
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVCEALMEREVLWANAPHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAKIATRTSVV
AASRDGQGWTITLEDTGTGRRENVHARLLVKAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHVAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggcacctcttcgcgcgcaaccaagctcattcacggtggtttgcgctatctggaa
cattatgaattccggctggtgtgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgccgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgcaccgacaaggccggcgaaccgttgaaaccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcttcgtggcg
ctcaccgcccgcgatgcggctgatcgcggcgcgaagatcgcgacccgaacgagcgtcgtt
gccgcaagccgcgacgggcagggctggaccatcacactggaagataccggcaccggcagg
cgtgagaacgtacacgcccgccttctggtcaaagccgccgggccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtgcagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaacgacggg
cgcatcatcttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcaccgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgacggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccagatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacagcacgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggcgccccatggacccatgtagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggccgtcattttggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagatattttgtggcggcgcaccaag
ctcggcctgcgcctgacggcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctaa

DBGET integrated database retrieval system