KEGG   Brucella canis RM6/66: DK60_98Help
Entry
DK60_98           CDS       T03270                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bcar  Brucella canis RM6/66
Pathway
bcar00061  Fatty acid biosynthesis
bcar00780  Biotin metabolism
bcar01100  Metabolic pathways
bcar01130  Biosynthesis of antibiotics
bcar01212  Fatty acid metabolism
Module
bcar_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bcar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DK60_98
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DK60_98
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DK60_98
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcar01004]
    DK60_98
Enzymes [BR:bcar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DK60_98
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DK60_98
Lipid biosynthesis proteins [BR:bcar01004]
 Fatty acid synthase
  Component type
   DK60_98
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIJ82623
LinkDB All DBs
Position
1:complement(101351..102169)
Genome map
AA seq 272 aa AA seqDB search
MEGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF
VLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVI
SAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGP
QGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSG
VTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgcaaggaaaacgcggcctcatcatgggggtcgcgaacaatcactca
ctggcctggggcattgcaaaacagctcgccgcacagggcgccgaactggccttcacctat
cagggtgatgcgctgggcaagcgcgtgaaacctcttgccgaacaggtcggctcggatttc
gtgctgccttgcgacgtggaggacatcgccaccgtcgatgccgttttcgaagaaatcgag
aagaagtggggcggtctcgatttcctcgtgcacgctatcggtttttccgacaagacggaa
ttgaagggccgctatgcagatgtcaccacgcgcgagaatttcagccgcacgatggtcatc
tccgcctattccttcacagaagtggcgcagcgcgctgaaaagctcatgaaggacggcggc
tcgatcctgacgctgacctatggcggatcgacccgaacgatccccaattacaacgtgatg
ggtgttgccaaggccgctctcgaggccatggtgcgctatcttgcagccgattacggcccg
cagggcatccgcgtcaacgcgatttccgcaggccccgtgcgcacgcttgctggcgccggg
atcggtgatgcccgcgcgattttcagctaccagcgccgcaactcgccgctgcgccgcacc
gtcgatatcgatgatgtcggcaaatcggcagtctatcttctgtccgatctttcaagcggt
gtgaccggcgaaatccatttcgttgattccggctataacatcgtttcgatgccgacgctg
gaagagctgaaaagttcggactccgaacgcggagaataa

DBGET integrated database retrieval system