KEGG   Bifidobacterium catenulatum: BBCT_0305Help
Entry
BBCT_0305         CDS       T03931                                 

Definition
(GenBank) dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bcat  Bifidobacterium catenulatum
Pathway
bcat00040  Pentose and glucuronate interconversions
bcat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBCT_0305
Enzymes [BR:bcat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BBCT_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: BAR01273
UniProt: B6XWW6
LinkDB All DBs
Position
393568..394608
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEEQGVINVREVPDVPAPGLGELKIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEASGTVVEVGPGVEGFKVGDRVAMEPGIPDMSSRASKLGMYNVDPAVRFFATPPIDG
CLCETVNHPAAFTYKLPDNVSFGEGALLEPLAVGMWSATKARIKPGDVCVVTGSGTVGML
TASCALAGGASKVLISDVSAIKLAIAAQIPGIIPVDLTKEDLVERVREETGGWGADVAFE
CSGSPKSYETFWKLIAPGGAAVIVGIPVNPVAIDITELQATEVRIENIFRYANVYQKAID
LVANGKLNLKPFITDTYAMEDTKAAFDRMAEGRPGDIKLQITVNND
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgttctcgaagagcagggcgtcatcaatgtgcgtgaggtgcctgacgtc
cccgcacctggtctaggcgagctgaagatcgcgccgcataccgttggtgtgtgcggttcc
gacctgcactattacactcatggtcgtgtgggcaaatatgtggtggagcagccgatgatt
ctcggtcatgaggcttccggcacggtggttgaggtcggtcctggcgtcgaaggcttcaaa
gtgggcgatcgtgtggccatggagcccggcattccggatatgagttcgcgtgccagcaaa
ctgggcatgtataacgtcgatcctgcggtgcgtttctttgccactccgccgattgatggc
tgcctgtgcgaaacggtgaaccatcctgcggcgttcacctacaagctgcccgacaatgtg
agcttcggtgagggtgcgctgcttgaaccgttggctgtgggcatgtggtccgccaccaag
gctcgtatcaagccgggcgatgtctgcgtggtcaccggatcgggtacggtcggcatgctg
accgcgtcgtgcgcgttggcaggtggcgcttccaaggtgctgatttctgatgtgtcggca
atcaaactggcgattgcggctcagattccaggtattattccggtggatctcaccaaagag
gatctggtggagcgcgtccgtgaggaaacggggggttggggtgctgatgtggctttcgag
tgctcgggctcgccgaagtcatacgagacattctggaagctgattgctcccggtggcgct
gccgttatcgttggcattccggtcaatccggtggctatcgacattacggaactgcaggct
accgaggtgcgcatcgaaaatatcttccgttatgccaatgtgtatcagaaggccattgac
ctcgtggctaacggtaaactgaatctgaagccattcatcaccgacacctatgcgatggag
gataccaaggcggcgttcgatcgcatggccgaggggcgtcctggagacattaagctgcag
attaccgtgaataacgactga

DBGET integrated database retrieval system