KEGG   Bacillus cereus B4264: BCB4264_A0258Help
Entry
BCB4264_A0258     CDS       T00805                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bcb  Bacillus cereus B4264
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BCB4264_A0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: ACK60250
UniProt: B7HJR8
LinkDB All DBs
Position
227458..228873
Genome map
AA seq 471 aa AA seqDB search
MKQIFQKKPIAKLMQESKQKTLARTLGALDLTMLGIGAIVGTGIFVLTGVVAAKHSGPAI
ILSFAIAALACAFAAFCYAEFASSVPVSGSVYTYTYATMGEVFAFLIGWDLMLEYLLATS
AVANGWSAYFQSLLKGFGIHIPTILSSAPGTGKGGIIDLPAVLIILVMTVLLSRGVRESA
RVNNIMVFIKIAVVLIFIFAGFNYVKPENWTPFMPFGLDGVMAGAATVFFAFIGFDAVST
AAEEVKRPQRDLPIGIIASLLICTVLYIVVSLILTGIVPYGQLNISDPVAFALQFIGQDG
LAGVISVGAITGITTVMLVMMYGQVRVSYAMSRDGLLPKRLAKVHPKFKTPFLNTWTTGI
IAALISGLIDLNVLAHLVNMGTLSAFALVAVAVIVMRRTHPDLPRAFKAPLVPFLPALTV
IFCLYLMLQLSGTAWISFGIWMVIGIAVYFLYSRKHSALNNSKKEEDVANL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatttttcaaaagaagccaattgcaaagttaatgcaagaaagtaagcaaaaa
acgttagcaagaacattgggcgcgctagatttaactatgcttggaatcggagcaattgtt
ggaactggtatttttgttctaacgggtgttgtggcagcgaaacattctgggccagctatt
atattatcatttgcgattgccgctctagcttgtgcctttgctgcattttgttatgctgaa
tttgcttcttcagttcctgtctcgggcagtgtgtatacgtatacatacgcgacgatgggg
gaagtattcgcatttttaattggctgggacttaatgctggaatatttacttgctacatct
gctgtagcgaacggttggtctgcatattttcaatctttattaaaggggtttggaattcat
attccgactattctctcctcggctcctggtacaggtaagggtggaataattgatctacct
gcagttctaattattttagtgatgacagttcttttatctaggggtgttcgtgaaagtgca
cgagtaaataacattatggtatttattaaaatagcagttgttcttatttttatctttgct
ggttttaattatgtgaaacctgaaaactggacgccttttatgccatttggtttagatggt
gtaatggctggagcggctacagtattcttcgcatttataggatttgatgcagtttcaaca
gcggcagaagaagtgaaacgtccgcaacgtgatttaccaattggtattattgcatcgtta
ttaatttgtacagttctttatatcgttgtttcgcttattttgacaggaattgttccatac
ggacagctaaatatatcagatccagttgcttttgcacttcaatttattggacaagatggt
ttagcgggggtaatttcggtaggagcaattacaggaattacaacagtaatgctagttatg
atgtatgggcaagttcgtgtttcttatgcgatgagccgagatggtttactgccgaaacgt
cttgctaaagttcatccgaaatttaaaacgccatttttaaatacatggacaacgggaatt
attgcggcactgatttcaggattaatagatttaaatgttttagcacatcttgtaaatatg
gggacattgtcagcatttgcactcgtagctgttgcggtaatcgtaatgagaagaacacat
ccagacttaccaagggcatttaaggctccgcttgtaccatttttaccagcattaacagtg
atcttctgtttatacttaatgcttcaattatcggggacagcatggattagttttgggata
tggatggttattggtatagcggtttacttcttatatagccgaaaacatagtgctttaaat
aatagtaaaaaagaagaagatgttgcaaatttataa

DBGET integrated database retrieval system