KEGG   Bacillus cereus B4264: BCB4264_A0260Help
Entry
BCB4264_A0260     CDS       T00805                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00473  D-Alanine metabolism
bcb00550  Peptidoglycan biosynthesis
bcb01100  Metabolic pathways
bcb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCB4264_A0260
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCB4264_A0260
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BCB4264_A0260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcb01011]
    BCB4264_A0260
Enzymes [BR:bcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCB4264_A0260
Peptidoglycan biosynthesis and degradation proteins [BR:bcb01011]
 Precursor biosynthesis
  Amino acid ligase
   BCB4264_A0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACK62228
UniProt: B7HJS0
LinkDB All DBs
Position
230482..231567
Genome map
AA seq 361 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITEQGQWVRGERIEGEVT
DVEALKMSGAENAISPLSLSTEIIPSAASEENAIDVIFPLLHGPNGEDGTVQGLLELMNI
PYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEKNREEAYSKVEDKLGYPC
FVKPANLGSSVGINKCKNREELEDAFVEAFQFDRKIIVEENIVGREVEVGVLGNDEPKCS
VVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKRDAIIAFQSLDGAGLTRADF
FLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELIEELIRLAIERHEEKQKIKYT
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtggaaaatcagctgagcatcaagtttcg
ctacagacggctcttgctgctattaaagcgttaaatcaagataaattcgagattcatcca
atttatattacagaacaaggtcaatgggtacgcggtgagcgtattgaaggcgaagtaaca
gatgttgaagctttaaaaatgagcggtgcagaaaatgcgatttctccgttatcattaagt
acagaaattatcccatctgcagcttctgaggagaacgctattgacgttattttcccatta
ctacatggaccaaacggtgaagatggaacggttcaaggactattagaattaatgaatatc
ccttatgtaggaaatggtgttctagcatcatctgctggtatggataaagttgttatgaaa
aacatctttgcagaggctggtttaaaacaagcaaaatatgcatccttcattcgtagtgca
tgggaaaaaaatcgtgaggaagcttattctaaagtagaagataagttaggatatccttgc
ttcgtaaaaccagcgaaccttggttcaagtgttggtattaataagtgtaaaaatcgtgaa
gaacttgaggatgcatttgtagaggcattccaatttgatcgcaaaattattgtagaagaa
aatattgtaggtcgtgaagtagaagttggggtactaggtaatgatgagccgaaatgttca
gttgtaggtgaaatcgttccgaaaaaggacttctatgattataagtcgaaatatatcgat
ggtgatacggcgctaattattccagctgaaatgacagaagaagaatctaatgtaattaag
cgtgatgcgattattgcattccaatcattagacggtgcaggtttaacgcgagctgatttc
ttcttaacgaaagatggagaagtgtatattaacgaagtaaacacaatgccaggatttaca
ccgttcagtatgttccctctattatggcaacatactgggttaccgtatccagaattaatc
gaagagctaattcgtttagcgattgaacgtcacgaagaaaaacaaaaaattaaatataca
atctaa

DBGET integrated database retrieval system