KEGG   Bacillus cereus B4264: BCB4264_A0316Help
Entry
BCB4264_A0316     CDS       T00805                                 

Definition
(GenBank) DNA-binding response regulator
Organism
bcb  Bacillus cereus B4264
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACK60806
UniProt: B7H4R9
LinkDB All DBs
Position
complement(281824..282537)
Genome map
AA seq 237 aa AA seqDB search
MKDIRILIADDDKEIRNLLKIYLERELYMVDTAINGEEALHLFNQNNYNLVILDLMMPKI
DGIEVCKKLRDKTNIPILMLTAKDHEVDKILGLSIGADDYITKPFSIHEVIARVKALMRR
FLVLGSNNTAQEKTTLSFKGLTINLNTYTVHTNKEEISLTGKELELLKFFTSNPGQVFTK
TQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQTIWGIGYKFVGEKLED
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatacgtatccttatagcagacgacgataaagaaatccgaaatttattaaaa
atatatttagaacgagaattatacatggtagacactgcaatcaacggcgaagaagcctta
catttatttaatcaaaataactataacctcgttatattagatcttatgatgcccaaaata
gatggaatcgaggtatgtaaaaaacttagagataaaactaacatacctatattaatgctc
accgctaaagatcacgaagttgataaaattttaggtttaagcattggtgctgatgattat
attacgaaacctttcagcattcacgaagtaattgcacgagtaaaagctcttatgcggcgt
tttttagttctcggaagtaacaatactgctcaagaaaaaacaactttatcttttaaagga
ctaactatcaatttaaatacatacacagttcatacaaacaaagaagaaattagcttaacc
ggaaaagaactggaactgttaaaattctttacttcaaacccagggcaagtatttacaaaa
acacagctcttccgaaatgtgtgggacgataattatatagaagatgataataccgttatg
gtacatattcgaaaactcagaaagaaaatagaaattgacccttccaatccaaaattcatt
cagactatatggggaattggttataagtttgtaggtgaaaagcttgaagactga

DBGET integrated database retrieval system