KEGG   Bacillus cereus B4264: BCB4264_A0391Help
Entry
BCB4264_A0391     CDS       T00805                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcb  Bacillus cereus B4264
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCB4264_A0391 (ahpF)
Enzymes [BR:bcb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCB4264_A0391 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACK63273
UniProt: B7H7C8
LinkDB All DBs
Position
complement(367586..369112)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPGENTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNPGITHTMIDGAAFKEEVESKDIMAVPTVYLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcaattaatggagaac
gatattttacttaaagtaagcgcaggagacgataacgtatctaaagatatgttagctcta
gtagacgaattagctactatgtcatctaagattacagtagaaaaagttgaattagagaga
acaccaagctttagcgtaaaccgccctggtgaaaacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacatcattagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttcttaaccctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacattatggcagtaccaactgtttacctaaacggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggt
gcaagtgcagcaatttacgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggcattgagaacttcatcagcgtgaaaaagact
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcgaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttctacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatattgcccacactgt
gacggtccattattcactggaaaagacgtagcagttatcggcggaggtaactctggtatt
gaagcagctatcgacttagcaggtatcgttaagcacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtattacaagagcgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaatcactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgtaccaaacacagactggttaggcgaaacagttgaacgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtgccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system