KEGG   Bacillus cereus B4264: BCB4264_A0638Help
Entry
BCB4264_A0638     CDS       T00805                                 

Definition
(GenBank) neutral protease Npr599
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bcb  Bacillus cereus B4264
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bcb01002]
    BCB4264_A0638
Enzymes [BR:bcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BCB4264_A0638
Peptidases [BR:bcb01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BCB4264_A0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ACK63100
UniProt: B7HBN7
LinkDB All DBs
Structure
PDB: 

Position
623763..625463
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRMQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKFNTIDHVTNDDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSNY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSNLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVAAVKQSFSAVGVN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacatttgga
gggacaggctctgcatttgcggattctaaaaatgtactctctacgaagaagtacaatgag
acagtacagtcacctgagtttatttctggtgatctaactggagcgactggtaagaaagcg
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattacaagctaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtagtacgtatgcaacaagtttacgaaggagtgcctgtatggggttctactcaagtggct
cacgtaagtaaagacggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaggaaaagttgaaaaataaaaataagattgaaggcgcaaaagcaattgaaatcgcg
cagcaagatttaggggtaacaccgaaatatgaagtagaaccaaaagcggacttatatgta
tatcaaaacggtgaggaaacaacatatgcatatgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaggcagacagcggtaaagtattaaataagttt
aatacaattgatcatgtgacgaatgatgataagtcaccagttaagcaagaggctcctaaa
caggatgcgaaagctgttgtaaagcctgtaacaggaacgaataaagtaggaactggtaaa
ggtgtattaggagatacgaagtcgcttaatacaacgttatctggatcatcttactactta
caagataatacacgcggggcaacgattttcacatatgatgcgaaaaaccgttcaacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcagca
gtagatgctcattactatgcaggtaaaacatatgattactataaagctacgtttaataga
aattctattaatgatgcaggagcaccgttaaaatcgacagttcattacggaagtaattat
aacaatgcattctggaacggatcacagatggtatacggagatggtgatggtgtaacgttt
acttcattatctggtggaattgatgtaattggtcacgagttaacgcatgctgttacggaa
aatagttcaaatctaatttatcaaaatgaatctggggctttaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccggattgggagattggtgaa
gatatttacacacctggtaaagcaggagacgcacttcgctctatgagtgatcctacgaag
tatggtgatccagaccattattctaagcgttacactggttcaagtgataacggtggtgtt
catacaaacagcggcattattaataaacaagcttatttattagcaaatggtggtacgcat
tatggtgtaactgtaactggtatcggtaaagataaattaggtgcgatttactaccgtgca
aatacacagtatttcacgcaatctactacatttagtcaagctcgtgctggtgcagtacaa
gctgctgcagacttatatggtgcaaattctgctgaagtagcagcagttaagcaatcattt
agtgctgttggtgtaaactaa

DBGET integrated database retrieval system