KEGG   Bacillus cereus B4264: BCB4264_A2070Help
Entry
BCB4264_A2070     CDS       T00805                                 

Gene name
dal2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcb  Bacillus cereus B4264
Pathway
bcb00473  D-Alanine metabolism
bcb01100  Metabolic pathways
bcb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCB4264_A2070 (dal2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BCB4264_A2070 (dal2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcb01011]
    BCB4264_A2070 (dal2)
Enzymes [BR:bcb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCB4264_A2070 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:bcb01011]
 Precursor biosynthesis
  Racemase
   BCB4264_A2070 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACK62746
UniProt: B7HJT0
LinkDB All DBs
Position
1974066..1975241
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
IHQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagcagga
atacatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcgggatcaatggaattaagtaacacatttcaa
aatatggtacgcgttggaataggagtgtatggtatgtatccgtcaaaagaagtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacat
gcgaagaagaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
atagcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacggggttcgagtacctgttattggccgtgtttgtatggatcagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system